|
|
| (5 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice gene Os05g0472700 was reported as '''''oszip5''''' in 2010<ref name="ref1" /> by researchers from Korea and USA. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os05g0472700 <=> oszip5, OsZIP8, ZIP8, OsZIP9 |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * '''''OsZIP5''''' is inducible under Zn deficiency. '''''OsZIP5''''' encodes a Zn transporter. |
| − | | + | * '''''OsZIP5''''' plays a role in Zn distribution within rice. |
| − | ===Expression=== | + | ===Mutation=== |
| − | Please input expression information here.
| + | * Knockout plants showed no visible phenotypic changes under either normal or deficient conditions. However, they were tolerant to excess Zn and contained less Zn. |
| | + | ===Overexpression=== |
| | + | * Transgenic plants overexpressing the gene grew less well. Overexpression of the gene decreased the Zn concentration in shoots, but caused it to rise in the roots. overexpressing transgenics were sensitive to excess Zn. |
| | | | |
| | + | ===sublocalization=== |
| | + | * The OsZIP5-GFP fusion protein was localized to the plasma membrane. |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| − |
| |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Department of Plant Molecular Systems Biotechnology and Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Republic of Korea |
| | + | * Integrative Biosciences and Biotechnology, Pohang University of Science and Technology (POSTECH), Pohang 790-784, Republic of Korea |
| | + | * Department of Biological Sciences, Dartmouth College, Hanover, NH 03755, USA |
| | + | ==References== |
| | + | <references> |
| | + | * <ref name="ref1"> |
| | + | Lee S, Jeong HJ, Kim SA, Lee J, Guerinot ML, An G. OsZIP5 is a plasma membrane |
| | + | zinc transporter in rice. Plant Mol Biol. 2010 Jul;73(4-5):507-17. doi: |
| | + | 10.1007/s11103-010-9637-0. PubMed PMID: 20419467. |
| | + | </ref> |
| | + | </references> |
| | | | |
| − | ==References==
| |
| − | Please input cited references here.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]] |
| − | GeneName = Os05g0472700|
| |
| − | Description = Similar to Metal transport protein|
| |
| − | Version = NM_001062353.1 GI:115464436 GeneID:4339082|
| |
| − | Length = 2493 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os05g0472700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
| |
| − | AP = Chromosome 5:23262252..23264744|
| |
| − | CDS = 23262385..23262990,23263138..23263287,23264203..23264508|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008398:23262252..23264744
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008398:23262252..23264744
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgacggcggcgatgaccaaggtgttcgtcctgctctttctggtggcggcgtgctacctgccggcgcacgcggcggcagcggagtgcgactgcgcgacggacacggcggggcgggacaaggcgcaggcgctgcggctcaaggtcatcgccatcttctgcatcctcgccgggagcaccgtcggggcggcgctgccgtccctgggcggcaggttcccggcgatccagccggagacggacgtgttcctctccgtcaaggccttcgccggcggcgtcatcctcgccacgggcctggtgcacatcctccccgcggccttcgaggcgctcagctcgccgtgcctcgtcggcggcccgtggaagcgcttcccgttcgccggcatggtcgccatggtctccgccatcggcacgctcatcgtcgacaccgtcgccacggggtacttccaccgcacggacgccaagaggaaggccgcggccgtcgccgacgagccagccgacgacctggaggcctccgacgagcacagccacggccacgcccacggcatgtccgtcatgtccgtcgctcccgccggcgaggaagacctcgtccgccaccgcgtcatctctcaggtgctggagctgggagtggtggtgcactcgctcatcatcgggatgtcgctgggcgcctccgacttcccgagcacggtgcggccgctcgtgccggcgctgacgtttcatcagttcttcgagggcatcgggctcggcggatgcatcgttcaggcaaagttccgtgtcaggtcagtggtgacgatggcgctcttcttctccctgacgacgccggccggcatcgtcgtcgggatcgggatctcctccgtctacgacgcgaacagcccaacggcgctggtggtgcaggggctcctcgaggcggcggcagcggggatactcgtctacatggcgctcgtcgacatcctcgccgaggacttcatgaagaccaaggtgcagagaaggggacgcctgcagctcgccatgaacgtcgcgttgctgctcggcgcagggctcatgtccatgatcgccatctgggcgtga</cdnaseq>|
| |
| − | AA = <aaseq>MATAAMTKVFVLLFLVAACYLPAHAAAAECDCATDTAGRDKAQA LRLKVIAIFCILAGSTVGAALPSLGGRFPAIQPETDVFLSVKAFAGGVILATGLVHIL PAAFEALSSPCLVGGPWKRFPFAGMVAMVSAIGTLIVDTVATGYFHRTDAKRKAAAVA DEPADDLEASDEHSHGHAHGMSVMSVAPAGEEDLVRHRVISQVLELGVVVHSLIIGMS LGASDFPSTVRPLVPALTFHQFFEGIGLGGCIVQAKFRVRSVVTMALFFSLTTPAGIV VGIGISSVYDANSPTALVVQGLLEAAAAGILVYMALVDILAEDFMKTKVQRRGRLQLA MNVALLLGAGLMSMIAIWA</aaseq>|
| |
| − | DNA = <dnaseqindica>134..739#887..1036#1952..2257#gtccacgggttcaaaaggcctagaagaacgaagcggagcttagctcgcgcatgtgccaacctgaacctccgctgcgaaacgccgcgacatctcgccgcgcgagctaagcttagctgcaggtgagccatcggcgatggcgacggcggcgatgaccaaggtgttcgtcctgctctttctggtggcggcgtgctacctgccggcgcacgcggcggcagcggagtgcgactgcgcgacggacacggcggggcgggacaaggcgcaggcgctgcggctcaaggtcatcgccatcttctgcatcctcgccgggagcaccgtcggggcggcgctgccgtccctgggcggcaggttcccggcgatccagccggagacggacgtgttcctctccgtcaaggccttcgccggcggcgtcatcctcgccacgggcctggtgcacatcctccccgcggccttcgaggcgctcagctcgccgtgcctcgtcggcggcccgtggaagcgcttcccgttcgccggcatggtcgccatggtctccgccatcggcacgctcatcgtcgacaccgtcgccacggggtacttccaccgcacggacgccaagaggaaggccgcggccgtcgccgacgagccagccgacgacctggaggcctccgacgagcacagccacggccacgcccacggcatgtccgtcatgtccgtcgctcccgccggcgaggaagacctcgtccgccaccgcgtcatctctcaggtatgtcatactacatctcccgccaccgcgccattcaagaaacagagctgcgaaaacaaaaaaacgcaaccaaattaagaaaattcaatcaaaatttctgttcttattttcttaatcgattttgcttgtgcgtccttgatggtggaggtgctggagctgggagtggtggtgcactcgctcatcatcgggatgtcgctgggcgcctccgacttcccgagcacggtgcggccgctcgtgccggcgctgacgtttcatcagttcttcgagggcatcgggctcggcggatgcatcgttcaggtgatttacccacacatttactccgcactcacaattgtcaatttcaacctgttttttttttttttcgagagagagagagagagagaaagatttcaacgtttttggtgttcatatcctatcaatccatcgtgcttactaactcgtccgaagataccgatttcaaacaagaggacaactgatgtcttgtactaccaaaaagttagaaaaagacgttccgattttgcagatttacagatgggccttagtactttgaggggcccagttgttaaatcacgactcaaatcgcatcccatcctacttccctgggcggctgggcctccactaattaatctcaatcaaaagtaatccttctattttatattattattaatcgttttaactttctttttaaaatttgactaagtttatagaaaaatataacaacattttaacccaaaacaaatatattatcaaaatatattttatgttaattttaatgaaattaatttcgtattgtagatgttaataatttttcggaattgctagaaaacttccgcaagtttttttttgcccccaaaaaactttcagatttgtggccatcagatcgcattgagatttgtgcatgaaggaaaataattggtagaaagaaattttcacccatctcacgcgtaagaacttgatgctaaccaaaacatagtagaatataagttttatataagttatattacagttacagcgcagttgcagtgtggttacgatgtaatttcacttcaattatattatagttatatctgaaaatttttcactcaaaaaacttactgcggttttcttaatactccttaatctttctataaatttaggtaaacttaaataagtttgattaagaaaaaagttaaaataacttataatataacctgttctttcttgtttctgcaggcaaagttccgtgtcaggtcagtggtgacgatggcgctcttcttctccctgacgacgccggccggcatcgtcgtcgggatcgggatctcctccgtctacgacgcgaacagcccaacggcgctggtggtgcaggggctcctcgaggcggcggcagcggggatactcgtctacatggcgctcgtcgacatcctcgccgaggacttcatgaagaccaaggtgcagagaaggggacgcctgcagctcgccatgaacgtcgcgttgctgctcggcgcagggctcatgtccatgatcgccatctgggcgtgatgagtgagtgaccatcacggccagcatgcgacgtgcggcgtttcaatttgttcggcaggaatggcaggtttttgttcttaggcgcgtctgatcacgctcgcgctctcgcgaagacctgagaattcgttcgaggatctcaaaagagagaccactccgttggttgaaactgacgaggagaggggtctcccgtgcacgatatgtagaacagttcagtgaccatgttactctgacttgac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062353.1 RefSeq:Os05g0472700]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 5]]
| |
| − | [[Category:Chromosome 5]]
| |
