Difference between revisions of "Os02g0820500"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os02g0820500''' was reported as ''' dh1''' in 2009 <ref name="ref1" /> by researchers from the USA.  
 
+
<br>
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''Os02g0820500 <=> dh1'''
 +
<br>
 
===Function===
 
===Function===
Please input function information here.
+
*The '''dh1''' presented severer mutation phenotype under relatively longer daylight than under shorter daylight implied that shorter daylight induced the expression of gene(s) redundant to DH1 in function and partially compensated for the loss-of-function.
 +
<br>
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*The result of transformation by a fused expression vector, '''pDH1::GFP''', revealed that '''DH1''' had the keen spatial and temporal characteristics of expressing at axillary bud, young panicle and floral organs but not at root, leaf, node and culm, and strongly expressing at young tissues but weakly at mature organs.
 
+
<br>
===Evolution===
 
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
===Mutant===
 +
*RNAi aimed at DH1 in wild type plants could partially result in the mutation phenotype of '''dh1'''.'''DH1''' could also rescue the mutation phenotype in the complement experiment.  
 +
<br>
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Daxue South-Road, Yangzhou, Jiangsu 225009, P.R. China
 
+
*Key Laboratory of Plant Functional Genomics of Educational Ministry, Yangzhou University, Yangzhou, Jiangsu 225009, P.R. China
 +
*Lixiahe Regional Agriculture & Science Research Institute of Jiangsu Province, Yangzhou 225007, P.R. China
 +
*National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China
 +
<br>
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
DH1, a LOB domain-like protein required for glume formation in rice
 +
</ref>
  
 +
</references>
 +
<br>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0820500|
 
Description = Similar to LOB domain protein 17|
 
Version = NM_001055078.1 GI:115449748 GeneID:4331170|
 
Length = 1107 bp|
 
Definition = Oryza sativa Japonica Group Os02g0820500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:36114364..36115470|
 
CDS = 36114606..36114935,36115042..36115362|
 
GCID = <gbrowseImage1>
 
name=NC_008395:36114364..36115470
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:36114364..36115470
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctggtgctacggctgccggcgctgccgctgccgcggcggggacgggagccgggtcgccgtgcggcgcgtgcaagttcttgcggcggcggtgcgtgccggagtgcgtgttcgcgccctacttcagctcggagcaaggggcggcgaggttcgcggcgatccacaaggtgttcggcgccagcaacgcctccaagctcctctcccacctccccgtcgccgaccgctgcgaggccgtcgtcaccatcacctacgaggcccaggccaggctccgcgaccccgtctatggctgcgtcgcccaaatcttcgccctccagcagcaggtcgcgatcctgcaagcgcagctgatgcaggcgagggcgcagctggcgtgcggcatccagagcagctcgcactctccggtgagctggccggacagcggcagcatcagcgcgctactccggcaggacatggcgagaaggccgcccggcggcgccctcgacgactgcttcggcggcggcggcgcgctgctgccggagctcatggcggccggcttcaaggacgacgtcgccgccgtgcagatgcagcagcattgctccaaggcggtggacgccggcgagctccagtatctggcccaggcgatgatgagatcaacctccaactactctcagtag</cdnaseq>|
 
AA = <aaseq>MAGATAAGAAAAAAGTGAGSPCGACKFLRRRCVPECVFAPYFSS                    EQGAARFAAIHKVFGASNASKLLSHLPVADRCEAVVTITYEAQARLRDPVYGCVAQIF                    ALQQQVAILQAQLMQARAQLACGIQSSSHSPVSWPDSGSISALLRQDMARRPPGGALD                    DCFGGGGALLPELMAAGFKDDVAAVQMQQHCSKAVDAGELQYLAQAMMRSTSNYSQ</aaseq>|
 
DNA = <dnaseqindica>536..865#109..429#ctactagcagctaacctacctacactacactacaccacacactacacttggagagaagcacacgtagctagagtgatcgattcattttcttgctcgatcttgatcggtatggctggtgctacggctgccggcgctgccgctgccgcggcggggacgggagccgggtcgccgtgcggcgcgtgcaagttcttgcggcggcggtgcgtgccggagtgcgtgttcgcgccctacttcagctcggagcaaggggcggcgaggttcgcggcgatccacaaggtgttcggcgccagcaacgcctccaagctcctctcccacctccccgtcgccgaccgctgcgaggccgtcgtcaccatcacctacgaggcccaggccaggctccgcgaccccgtctatggctgcgtcgcccaaatcttcgccctccagcagcaggtactatttcatttcatggatgagaatgagatgatctcgtcgctgctcgatcgatcgatcgatcgcctctcggatttgtgactgattcgatcgatgctacatacaggtcgcgatcctgcaagcgcagctgatgcaggcgagggcgcagctggcgtgcggcatccagagcagctcgcactctccggtgagctggccggacagcggcagcatcagcgcgctactccggcaggacatggcgagaaggccgcccggcggcgccctcgacgactgcttcggcggcggcggcgcgctgctgccggagctcatggcggccggcttcaaggacgacgtcgccgccgtgcagatgcagcagcattgctccaaggcggtggacgccggcgagctccagtatctggcccaggcgatgatgagatcaacctccaactactctcagtagaaagaaaaatcaaacaatgcaacgctttgcatgcaggagttagagagtggacaagcaaaaatttagcctgtgtactactgaacttttttatcagtgcaacgtcatagtgaagcaattagtctgcttcatgatgatgattagtacgtagtactactaaataacactaatagcttcttgcaacaaggtcttggtaatgacatcacacatcactggaccctggccatgcatgcatgtccaagtat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055078.1 RefSeq:Os02g0820500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 04:24, 21 November 2016

The rice Os02g0820500 was reported as dh1 in 2009 [1] by researchers from the USA.

Annotated Information

Gene Symbol

  • Os02g0820500 <=> dh1


Function

  • The dh1 presented severer mutation phenotype under relatively longer daylight than under shorter daylight implied that shorter daylight induced the expression of gene(s) redundant to DH1 in function and partially compensated for the loss-of-function.


Expression

  • The result of transformation by a fused expression vector, pDH1::GFP, revealed that DH1 had the keen spatial and temporal characteristics of expressing at axillary bud, young panicle and floral organs but not at root, leaf, node and culm, and strongly expressing at young tissues but weakly at mature organs.


Mutant

  • RNAi aimed at DH1 in wild type plants could partially result in the mutation phenotype of dh1.DH1 could also rescue the mutation phenotype in the complement experiment.


Labs working on this gene

  • Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Daxue South-Road, Yangzhou, Jiangsu 225009, P.R. China
  • Key Laboratory of Plant Functional Genomics of Educational Ministry, Yangzhou University, Yangzhou, Jiangsu 225009, P.R. China
  • Lixiahe Regional Agriculture & Science Research Institute of Jiangsu Province, Yangzhou 225007, P.R. China
  • National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China


References

  1. DH1, a LOB domain-like protein required for glume formation in rice


Structured Information