Difference between revisions of "Os02g0820500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0820500| Description = Similar to LOB domain protein 17| Version = NM_001055078.1 GI:115449748 GeneID:4331170| Length = 1107 bp| Definitio...")
 
(Annotated Information)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''Os02g0820500''' was reported as ''' dh1''' in 2009 <ref name="ref1" /> by researchers from the USA.
GeneName = Os02g0820500|
+
<br>
Description = Similar to LOB domain protein 17|
+
==Annotated Information==
Version = NM_001055078.1 GI:115449748 GeneID:4331170|
+
===Gene Symbol===
Length = 1107 bp|
+
*'''Os02g0820500 <=> dh1'''
Definition = Oryza sativa Japonica Group Os02g0820500, complete gene.|
+
<br>
Source = Oryza sativa Japonica Group
+
===Function===
 +
*The '''dh1''' presented severer mutation phenotype under relatively longer daylight than under shorter daylight implied that shorter daylight induced the expression of gene(s) redundant to DH1 in function and partially compensated for the loss-of-function.
 +
<br>
  
  ORGANISM  Oryza sativa Japonica Group
+
===Expression===
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
*The result of transformation by a fused expression vector, '''pDH1::GFP''', revealed that '''DH1''' had the keen spatial and temporal characteristics of expressing at axillary bud, young panicle and floral organs but not at root, leaf, node and culm, and strongly expressing at young tissues but weakly at mature organs.
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
<br>
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Mutant===
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
+
*RNAi aimed at DH1 in wild type plants could partially result in the mutation phenotype of '''dh1'''.'''DH1''' could also rescue the mutation phenotype in the complement experiment.  
AP = Chromosome 2:36114364..36115470|
+
<br>
CDS = 36114606..36114935,36115042..36115362|
+
 
GCID = <gbrowseImage1>
+
==Labs working on this gene==
name=NC_008395:36114364..36115470
+
*Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Daxue South-Road, Yangzhou, Jiangsu 225009, P.R. China
source=RiceChromosome02
+
*Key Laboratory of Plant Functional Genomics of Educational Ministry, Yangzhou University, Yangzhou, Jiangsu 225009, P.R. China
preset=GeneLocation
+
*Lixiahe Regional Agriculture & Science Research Institute of Jiangsu Province, Yangzhou 225007, P.R. China
</gbrowseImage1>|
+
*National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China
GSID = <gbrowseImage2>
+
<br>
name=NC_008395:36114364..36115470
+
==References==
source=RiceChromosome02
+
<references>
preset=GeneLocation
+
<ref name="ref1">
</gbrowseImage2>|
+
DH1, a LOB domain-like protein required for glume formation in rice
CDNA = <cdnaseq>atggctggtgctacggctgccggcgctgccgctgccgcggcggggacgggagccgggtcgccgtgcggcgcgtgcaagttcttgcggcggcggtgcgtgccggagtgcgtgttcgcgccctacttcagctcggagcaaggggcggcgaggttcgcggcgatccacaaggtgttcggcgccagcaacgcctccaagctcctctcccacctccccgtcgccgaccgctgcgaggccgtcgtcaccatcacctacgaggcccaggccaggctccgcgaccccgtctatggctgcgtcgcccaaatcttcgccctccagcagcaggtcgcgatcctgcaagcgcagctgatgcaggcgagggcgcagctggcgtgcggcatccagagcagctcgcactctccggtgagctggccggacagcggcagcatcagcgcgctactccggcaggacatggcgagaaggccgcccggcggcgccctcgacgactgcttcggcggcggcggcgcgctgctgccggagctcatggcggccggcttcaaggacgacgtcgccgccgtgcagatgcagcagcattgctccaaggcggtggacgccggcgagctccagtatctggcccaggcgatgatgagatcaacctccaactactctcagtag</cdnaseq>|
+
</ref>
AA = <aaseq>MAGATAAGAAAAAAGTGAGSPCGACKFLRRRCVPECVFAPYFSS                    EQGAARFAAIHKVFGASNASKLLSHLPVADRCEAVVTITYEAQARLRDPVYGCVAQIF                    ALQQQVAILQAQLMQARAQLACGIQSSSHSPVSWPDSGSISALLRQDMARRPPGGALD                    DCFGGGGALLPELMAAGFKDDVAAVQMQQHCSKAVDAGELQYLAQAMMRSTSNYSQ</aaseq>|
+
 
DNA = <dnaseqindica>536..865#109..429#ctactagcagctaacctacctacactacactacaccacacactacacttggagagaagcacacgtagctagagtgatcgattcattttcttgctcgatcttgatcggtatggctggtgctacggctgccggcgctgccgctgccgcggcggggacgggagccgggtcgccgtgcggcgcgtgcaagttcttgcggcggcggtgcgtgccggagtgcgtgttcgcgccctacttcagctcggagcaaggggcggcgaggttcgcggcgatccacaaggtgttcggcgccagcaacgcctccaagctcctctcccacctccccgtcgccgaccgctgcgaggccgtcgtcaccatcacctacgaggcccaggccaggctccgcgaccccgtctatggctgcgtcgcccaaatcttcgccctccagcagcaggtactatttcatttcatggatgagaatgagatgatctcgtcgctgctcgatcgatcgatcgatcgcctctcggatttgtgactgattcgatcgatgctacatacaggtcgcgatcctgcaagcgcagctgatgcaggcgagggcgcagctggcgtgcggcatccagagcagctcgcactctccggtgagctggccggacagcggcagcatcagcgcgctactccggcaggacatggcgagaaggccgcccggcggcgccctcgacgactgcttcggcggcggcggcgcgctgctgccggagctcatggcggccggcttcaaggacgacgtcgccgccgtgcagatgcagcagcattgctccaaggcggtggacgccggcgagctccagtatctggcccaggcgatgatgagatcaacctccaactactctcagtagaaagaaaaatcaaacaatgcaacgctttgcatgcaggagttagagagtggacaagcaaaaatttagcctgtgtactactgaacttttttatcagtgcaacgtcatagtgaagcaattagtctgcttcatgatgatgattagtacgtagtactactaaataacactaatagcttcttgcaacaaggtcttggtaatgacatcacacatcactggaccctggccatgcatgcatgtccaagtat</dnaseqindica>|
+
</references>
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055078.1 RefSeq:Os02g0820500]|
+
<br>
}}
+
==Structured Information==
[[Category:Genes]]
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 04:24, 21 November 2016

The rice Os02g0820500 was reported as dh1 in 2009 [1] by researchers from the USA.

Annotated Information

Gene Symbol

  • Os02g0820500 <=> dh1


Function

  • The dh1 presented severer mutation phenotype under relatively longer daylight than under shorter daylight implied that shorter daylight induced the expression of gene(s) redundant to DH1 in function and partially compensated for the loss-of-function.


Expression

  • The result of transformation by a fused expression vector, pDH1::GFP, revealed that DH1 had the keen spatial and temporal characteristics of expressing at axillary bud, young panicle and floral organs but not at root, leaf, node and culm, and strongly expressing at young tissues but weakly at mature organs.


Mutant

  • RNAi aimed at DH1 in wild type plants could partially result in the mutation phenotype of dh1.DH1 could also rescue the mutation phenotype in the complement experiment.


Labs working on this gene

  • Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Daxue South-Road, Yangzhou, Jiangsu 225009, P.R. China
  • Key Laboratory of Plant Functional Genomics of Educational Ministry, Yangzhou University, Yangzhou, Jiangsu 225009, P.R. China
  • Lixiahe Regional Agriculture & Science Research Institute of Jiangsu Province, Yangzhou 225007, P.R. China
  • National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China


References

  1. DH1, a LOB domain-like protein required for glume formation in rice


Structured Information