Difference between revisions of "Os05g0578900"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0578900| Description = Similar to GATA transcription factor 16| Version = NM_001062950.1 GI:115465630 GeneID:4339709| Length = 1266 bp| De...")
 
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice gene Os05g0578900 was reported as '''''nl1''''' in 2009<ref name="ref1" /> by researchers from China.
GeneName = Os05g0578900|
 
Description = Similar to GATA transcription factor 16|
 
Version = NM_001062950.1 GI:115465630 GeneID:4339709|
 
Length = 1266 bp|
 
Definition = Oryza sativa Japonica Group Os05g0578900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os05g0578900 <=> nl1, OsGATA15
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
+
* The '''''NL1''''' gene encodes a GATA-type transcription factor with a single zinc finger domain, and its transcripts are detected predominantly in the bract primordia, which normally degenerate in the wild-type plants.
AP = Chromosome 5:28899186..28900451|
+
* '''''NL1''''' is an intrinsic factor that modulates and coordinates organogenesis through regulating the expression of '''''PLA1''''' and other regulatory genes during reproductive development in rice.
CDS = 28899233..28899751,28899872..28900192|
+
===Mutation===
GCID = <gbrowseImage1>
+
[[File:Os05g0578900-1.png|right|thumb|400px|'''Figure 1 Mutants affecting the pattern formation during panicle development.''' '' <ref name="ref1" />.'']]
name=NC_008398:28899186..28900451
+
* '''''nl1''''' mutation results in delays in flowering time, smaller panicles with overgrown bracts and abnormal UPI elongation patterns.
source=RiceChromosome05
+
 
preset=GeneLocation
+
===Overexpression===
</gbrowseImage1>|
+
* Overexpression of '''''NL1''''' in transgenic plants often gives rise to severe growth retardation, less vegetative phytomers and smaller leaves, suggesting that NL1 plays an important role in organ differentiation.
GSID = <gbrowseImage2>
+
 
name=NC_008398:28899186..28900451
+
===Expression ===
source=RiceChromosome05
+
* The researchers investigated '''''NL1''''' temporal and spatial expression patterns. NL1 was strongly expressed in young inflorescences and weakly expressed in the roots and elongating internodes as shown by RT-PCR analysis.
preset=GeneLocation
+
 
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atgcttcaccattactacagcggcggcgccggccatcatcaggacgtcgctgcagctggtagccccggcgacatggcttcctccaccttctcgctcttcttcccgatgtccaatgggcagtgttggccgccgtcgacggtggaggagtccgcggcctacgacgaccacagcaccgtcaccacctctccttcctcgccttcgtcgtcctccaccggctccgtcgactgcacgctctcgctcggcacgccgtcgtctcgccgcgccgagcccgtcgcggcggcggcgccagcggcaaaccatggggcgcccgtgccggcgcattatccgtcgctgtcagcggcgaccgtgtcctgggacgcgactgccgagtcgtactattgtggccagcaggggaggccggccaccggcgccgccaagtgcgccgccggcgccgggcacgacgcgctcctcgaccgccgctgcgccaactgcggcaccgcgtccacgccgctctggaggaacggccctcgcggacccaagtcgctgtgcaacgcgtgcgggatcaggtacaagaaggaggagcggcgcgcggcggcgacgacgacgacggccgacggcgccgccggatgcggcttcatcaccgcgcagcgtggacgcgggtcgaccgcggccaaggcggcgcccgccgtgacgacgtgcggcgaggagacgtcaccgtacgtcgtcggcggcggcggcggcggcggcgaggtcgcggacgcggcgtatctcgcctggcggctcaacgtcgtcccaccggcggcgacggcgacggcgttctcggtgtggccggagcgagctagcctctaccactacaactag</cdnaseq>|
+
 
AA = <aaseq>MLHHYYSGGAGHHQDVAAAGSPGDMASSTFSLFFPMSNGQCWPP                    STVEESAAYDDHSTVTTSPSSPSSSSTGSVDCTLSLGTPSSRRAEPVAAAAPAANHGA                    PVPAHYPSLSAATVSWDATAESYYCGQQGRPATGAAKCAAGAGHDALLDRRCANCGTA                    STPLWRNGPRGPKSLCNACGIRYKKEERRAAATTTTADGAAGCGFITAQRGRGSTAAK                    AAPAVTTCGEETSPYVVGGGGGGGEVADAAYLAWRLNVVPPAATATAFSVWPERASLY                    HYN</aaseq>|
+
You can also add sub-section(s) at will.
DNA = <dnaseqindica>48..566#687..1007#gtagagtgttgtgaatagccagttcagttcatcagttgataggagccatgcttcaccattactacagcggcggcgccggccatcatcaggacgtcgctgcagctggtagccccggcgacatggcttcctccaccttctcgctcttcttcccgatgtccaatgggcagtgttggccgccgtcgacggtggaggagtccgcggcctacgacgaccacagcaccgtcaccacctctccttcctcgccttcgtcgtcctccaccggctccgtcgactgcacgctctcgctcggcacgccgtcgtctcgccgcgccgagcccgtcgcggcggcggcgccagcggcaaaccatggggcgcccgtgccggcgcattatccgtcgctgtcagcggcgaccgtgtcctgggacgcgactgccgagtcgtactattgtggccagcaggggaggccggccaccggcgccgccaagtgcgccgccggcgccgggcacgacgcgctcctcgaccgccgctgcgccaactgcggcaccgcgtccacgccgctctggaggaacggccctcgcggacccaaggttcgtcgccggcgacgctcgctctcgccgtcgctgttctctatctctgcagttcacttcgcggtttcgccgacgtacgtcgtgtcgctgacattgccgccgtcgtacgtttctctgcagtcgctgtgcaacgcgtgcgggatcaggtacaagaaggaggagcggcgcgcggcggcgacgacgacgacggccgacggcgccgccggatgcggcttcatcaccgcgcagcgtggacgcgggtcgaccgcggccaaggcggcgcccgccgtgacgacgtgcggcgaggagacgtcaccgtacgtcgtcggcggcggcggcggcggcggcgaggtcgcggacgcggcgtatctcgcctggcggctcaacgtcgtcccaccggcggcgacggcgacggcgttctcggtgtggccggagcgagctagcctctaccactacaactagctataggcgattaactagtgtagcattagcgttggggagaagggaagctgcaccgtttttttggggaacattttgtacggtcgcacgctcccggattgatcgaactgtatgcatctgctgtgctgtgttgcacgctagctagctagatgactctgatcttgaaacgaaccgtgatcatttcattcatttggaatgaacatgtagctgtgcaaggtcatcttgctcggaaaattcataatcttccaatctcttgtgctgc</dnaseqindica>|
+
==Labs working on this gene==
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062950.1 RefSeq:Os05g0578900]|
+
* National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Graduate School of the Chinese Academy of Sciences, Chinese Academy of Sciences, Shanghai 200032, China;
}}
+
* China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China
[[Category:Genes]]
+
==References==
[[Category:Japonica mRNA]]
+
<references>
[[Category:Oryza Sativa Japonica Group]]
+
* <ref name="ref1">
[[Category:Japonica Genes]]
+
Wang L, Yin H, Qian Q, Yang J, Huang C, Hu X, Luo D. NECK LEAF 1, a GATA type
[[Category:Japonica Chromosome 5]]
+
transcription factor, modulates organogenesis by regulating the expression of
[[Category:Chromosome 5]]
+
multiple regulatory genes during reproductive development in rice. Cell Res. 2009
 +
May;19(5):598-611. doi: 10.1038/cr.2009.36. PubMed PMID: 19337211.
 +
 
 +
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]

Latest revision as of 02:33, 10 December 2016

The rice gene Os05g0578900 was reported as nl1 in 2009[1] by researchers from China.

Annotated Information

Gene Symbol

  • Os05g0578900 <=> nl1, OsGATA15

Function

  • The NL1 gene encodes a GATA-type transcription factor with a single zinc finger domain, and its transcripts are detected predominantly in the bract primordia, which normally degenerate in the wild-type plants.
  • NL1 is an intrinsic factor that modulates and coordinates organogenesis through regulating the expression of PLA1 and other regulatory genes during reproductive development in rice.

Mutation

Figure 1 Mutants affecting the pattern formation during panicle development. [1].
  • nl1 mutation results in delays in flowering time, smaller panicles with overgrown bracts and abnormal UPI elongation patterns.

Overexpression

  • Overexpression of NL1 in transgenic plants often gives rise to severe growth retardation, less vegetative phytomers and smaller leaves, suggesting that NL1 plays an important role in organ differentiation.

Expression

  • The researchers investigated NL1 temporal and spatial expression patterns. NL1 was strongly expressed in young inflorescences and weakly expressed in the roots and elongating internodes as shown by RT-PCR analysis.


You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Graduate School of the Chinese Academy of Sciences, Chinese Academy of Sciences, Shanghai 200032, China;
  • China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China

References

  1. 1.0 1.1 Wang L, Yin H, Qian Q, Yang J, Huang C, Hu X, Luo D. NECK LEAF 1, a GATA type transcription factor, modulates organogenesis by regulating the expression of multiple regulatory genes during reproductive development in rice. Cell Res. 2009 May;19(5):598-611. doi: 10.1038/cr.2009.36. PubMed PMID: 19337211.


Structured Information