Difference between revisions of "Os06g0136900"

From RiceWiki
Jump to: navigation, search
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os06g0136900 was reported as '''''dp1''''' in 2011<ref name="ref1" /> by researchers from China.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os06g0136900 <=> DP1,OSDP1
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''DP1''''' gene encodes a nuclear-localized AT-hook DNA binding protein, suggesting a grass-specific role of chromatin architecture modification in flower development.
 +
* The researchers further found that '''''SDP1'''''/'''''REP1''''' is downstreamly regulated by '''''DP1'''''.
 +
===Mutation===
 +
* The depressed palea1 (dp1) mutants show a primary defect in the main structure of palea, implying that palea is a fusion between the main structure and marginal tissues on both sides. The sterile lemma at the palea side is occasionally elongated in dp1 mutants. In addition, we found a floral organ number increase in dp1 mutants at low penetration.
 +
[[File:Os06g0136900-1.png|center|thumb|400px|'''Fig. 1. Phenotype of dp1mutants.''' '' <ref name="ref1" />.'']]
 +
 
 +
===Expression ===
  
===Expression===
 
Please input expression information here.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
==Labs working on this gene==
 +
* State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences,
 +
Beijing 100101, China
 +
* Ministry of Education Key Laboratory of Agriculture Biodiversity for Plant Disease Management, Key Laboratory of Plant Pathology of Yunnan Province, Yunnan Agricultural University,
 +
Kunming 650201, China
 +
* Key Laboratory of Genome Science and Information, Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing 100029, China
 +
* National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Jin Y, Luo Q, Tong H, Wang A, Cheng Z, Tang J, Li D, Zhao X, Li X, Wan J, Jiao
 +
Y, Chu C, Zhu L. An AT-hook gene is required for palea formation and floral organ
 +
number control in rice. Dev Biol. 2011 Nov 15;359(2):277-88. doi:
 +
10.1016/j.ydbio.2011.08.023. PubMed PMID: 21924254.
  
==Labs working on this gene==
+
</ref>
Please input related labs here.
+
</references>
  
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
GeneName = Os06g0136900|
 
Description = Protein of unknown function DUF296 domain containing protein|
 
Version = NM_001063265.1 GI:115466261 GeneID:4340045|
 
Length = 1275 bp|
 
Definition = Oryza sativa Japonica Group Os06g0136900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:1961307..1962581|
 
CDS = 1961520..1962506|
 
GCID = <gbrowseImage1>
 
name=NC_008399:1961307..1962581
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:1961307..1962581
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggatccggtgacggcggcggcggcgcatgggggtgggcaccaccaccaccaccacttcggagcgccaccggtggcggcgttccaccaccacccgttccaccacggcggcggggcgcactacccggcggcgttccagcagtttcaggaggagcagcagcagcttgtggcggcggcggcggcggctggtgggatggcgaagcaggagctggtggatgagagcaacaacaccatcaacagcggcgggagcaacgggagcggcggggaggagcagaggcagcagtccggggaggagcagcaccagcaaggggcggcggcgccggtggtgatccggcgtcccaggggccgccccgccggctccaagaacaagcccaagcctccggtcatcatcacgcgcgacagcgccagcgcgctgcgggcgcacgtcctcgaggtcgcctccgggtgcgacctcgtcgacagcgtcgccacgttcgcgcgccgccgccaggtcggtgtctgcgtgctcagcgccaccggcgccgtcaccaacgtctccgtccggcagcccggcgcgggccccggcgccgtcgtcaacctcaccggccgcttcgacatcctctcgctgtccggctccttcctcccgccgccggcgcctccctccgccaccggcctcaccgtctacgtctccggcggccaggggcaggtcgtgggcggcacggtcgccggaccgctcatcgccgtcggccccgtcgtcatcatggccgcctcgttcgggaacgccgcctacgagcgcctcccgctcgaggacgacgagccgccgcagcacatggcgggcggcggccagtcctcgccgccgccgccgccgctgccattaccaccacaccagcagccgattcttcaagaccatctgccacacaacctgatgaacggaatccacctccccggcgacgccgcctacggctggaccagcggcggcggcggcggcggccgcgcggcgccgtactga</cdnaseq>|
 
AA = <aaseq>MDPVTAAAAHGGGHHHHHHFGAPPVAAFHHHPFHHGGGAHYPAA                    FQQFQEEQQQLVAAAAAAGGMAKQELVDESNNTINSGGSNGSGGEEQRQQSGEEQHQQ                    GAAAPVVIRRPRGRPAGSKNKPKPPVIITRDSASALRAHVLEVASGCDLVDSVATFAR                    RRQVGVCVLSATGAVTNVSVRQPGAGPGAVVNLTGRFDILSLSGSFLPPPAPPSATGL                    TVYVSGGQGQVVGGTVAGPLIAVGPVVIMAASFGNAAYERLPLEDDEPPQHMAGGGQS                    SPPPPPLPLPPHQQPILQDHLPHNLMNGIHLPGDAAYGWTSGGGGGGRAAPY</aaseq>|
 
DNA = <dnaseqindica>76..1062#aaaccaaacccctcgcctccgctttgaccaccgccgcgccgcgccacgccgcgccaccgtgagagagggagacagatggatccggtgacggcggcggcggcgcatgggggtgggcaccaccaccaccaccacttcggagcgccaccggtggcggcgttccaccaccacccgttccaccacggcggcggggcgcactacccggcggcgttccagcagtttcaggaggagcagcagcagcttgtggcggcggcggcggcggctggtgggatggcgaagcaggagctggtggatgagagcaacaacaccatcaacagcggcgggagcaacgggagcggcggggaggagcagaggcagcagtccggggaggagcagcaccagcaaggggcggcggcgccggtggtgatccggcgtcccaggggccgccccgccggctccaagaacaagcccaagcctccggtcatcatcacgcgcgacagcgccagcgcgctgcgggcgcacgtcctcgaggtcgcctccgggtgcgacctcgtcgacagcgtcgccacgttcgcgcgccgccgccaggtcggtgtctgcgtgctcagcgccaccggcgccgtcaccaacgtctccgtccggcagcccggcgcgggccccggcgccgtcgtcaacctcaccggccgcttcgacatcctctcgctgtccggctccttcctcccgccgccggcgcctccctccgccaccggcctcaccgtctacgtctccggcggccaggggcaggtcgtgggcggcacggtcgccggaccgctcatcgccgtcggccccgtcgtcatcatggccgcctcgttcgggaacgccgcctacgagcgcctcccgctcgaggacgacgagccgccgcagcacatggcgggcggcggccagtcctcgccgccgccgccgccgctgccattaccaccacaccagcagccgattcttcaagaccatctgccacacaacctgatgaacggaatccacctccccggcgacgccgcctacggctggaccagcggcggcggcggcggcggccgcgcggcgccgtactgatcaacatcgatctcgccggagagaaaaaaaatggaggagaaggatcggagcgagccgtgcatggtgtaggatgaattaagctaagagttaatttcttcttccgcctttgctaatcatgatgctctcgtgttgtttaatctgtggcaatctgcttaattgcaagctcatcactgcaattaagcagcagctaaggatggttggatggttaaaact</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063265.1 RefSeq:Os06g0136900]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 6]]
 
[[Category:Chromosome 6]]
 

Latest revision as of 06:42, 10 December 2016

The rice gene Os06g0136900 was reported as dp1 in 2011[1] by researchers from China.

Annotated Information

Gene Symbol

  • Os06g0136900 <=> DP1,OSDP1

Function

  • DP1 gene encodes a nuclear-localized AT-hook DNA binding protein, suggesting a grass-specific role of chromatin architecture modification in flower development.
  • The researchers further found that SDP1/REP1 is downstreamly regulated by DP1.

Mutation

  • The depressed palea1 (dp1) mutants show a primary defect in the main structure of palea, implying that palea is a fusion between the main structure and marginal tissues on both sides. The sterile lemma at the palea side is occasionally elongated in dp1 mutants. In addition, we found a floral organ number increase in dp1 mutants at low penetration.
Fig. 1. Phenotype of dp1mutants. [1].

Expression

Evolution

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences,

Beijing 100101, China

  • Ministry of Education Key Laboratory of Agriculture Biodiversity for Plant Disease Management, Key Laboratory of Plant Pathology of Yunnan Province, Yunnan Agricultural University,

Kunming 650201, China

  • Key Laboratory of Genome Science and Information, Beijing Institute of Genomics, Chinese Academy of Sciences, Beijing 100029, China
  • National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China

References

  1. 1.0 1.1 Jin Y, Luo Q, Tong H, Wang A, Cheng Z, Tang J, Li D, Zhao X, Li X, Wan J, Jiao Y, Chu C, Zhu L. An AT-hook gene is required for palea formation and floral organ number control in rice. Dev Biol. 2011 Nov 15;359(2):277-88. doi: 10.1016/j.ydbio.2011.08.023. PubMed PMID: 21924254.


Structured Information