Difference between revisions of "Os06g0257450"

From RiceWiki
Jump to: navigation, search
(Function)
 
(5 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os06g0257450 was reported as '''''st1''''' in 2009<ref name="ref1" /> by researchers from USA and Japan.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os06g0257450 <=> st1(ws1), ws1, st1, RNRS1, rnrs1
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''V3''''' and '''''St1''''', which encode the large and small subunits of ribonucleotide reductase (RNR), RNRL1, and RNRS1, respectively. RNR regulates the rate of deoxyribonucleotide production for DNA synthesis and repair.
 +
 
 +
* The researchers found that the chlorotic phenotypes of v3 and st1 mutants are conditionally developed by missense mutations in the RNR subunits demonstrates that chloroplast biogenesis is arrested when plants fail to satisfy an increased requirement of RNR activity, particularly under restrictive temperatures or during the most active growth period (tillering stage).
 +
 
 +
===Mutation===
 +
* The virescent3 (v3) and stripe1 (st1) mutants in rice (Oryza sativa) produce chlorotic leaves in a growth stage-dependent manner under field conditions. They are temperature-conditional mutants that produce bleached leaves at a constant 20℃ or 30℃ but almost green leaves under diurnal 30℃/20℃ conditions.
 +
 
 +
===Expression ===
  
===Expression===
 
Please input expression information here.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
==Labs working on this gene==
 +
* Section of Plant Biology, College of Biological Sciences, University of California, Davis, CA 95616.
 +
* Present address: Biotechnology Laboratory, Toyota Central R&D Labs, Inc., Nagakute, Aichi 480¨C1192, Japan.
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Yoo SC, Cho SH, Sugimoto H, Li J, Kusumi K, Koh HJ, Iba K, Paek NC. Rice
 +
virescent3 and stripe1 encoding the large and small subunits of ribonucleotide
 +
reductase are required for chloroplast biogenesis during early leaf development.
 +
Plant Physiol. 2009 May;150(1):388-401. doi: 10.1104/pp.109.136648. PubMed PMID:
 +
19297585; PubMed Central PMCID: PMC2675711.
  
==Labs working on this gene==
+
</ref>
Please input related labs here.
+
</references>
  
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
GeneName = Os06g0257450|
 
Description = Ribonucleotide reductase family protein|
 
Version = NM_001187771.1 GI:297724672 GeneID:9266846|
 
Length = 1258 bp|
 
Definition = Oryza sativa Japonica Group Os06g0257450, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:8229879..8231136|
 
CDS = 8230046..8230296,8230898..8231135|
 
GCID = <gbrowseImage1>
 
name=NC_008399:8229879..8231136
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:8229879..8231136
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ccacgccgccgccgccgaatccccacaaccccaaatccccatccagaaaccaccccgatccgcgacgaagatgccggccgcgccgacgctggtgcccgcctgcgacctggaggagccgctgctggcggagtcgtccgagcgattctcgatgttcccgatcaggtacccgcagatctgggagttctacaagaaggcggtggcgtcgttctggacggcggaggaggtggacctctccgcctcgtcggcatgaacggcgacctcatgagccagtacatcgagttcgtcgccgaccgcctcctcatggcgctcggctgcaagaagatgtacaacgtcgctaaccccttcgactggatggagctcatatccctgcagggcaagaccaacttcttcgagaagcgcgtcggcgactaccagaaggcgtccgtcatgtcgagcctcaacggcggcgcctccgccaaccacgtcttcagcatcgacgaagacttctga</cdnaseq>|
 
AA = <aaseq>PRRRRRIPTTPNPHPETTPIRDEDAGRADAGARLRPGGAAAGGV                    VRAILDVPDQVPADLGVLQEGGGVVLDGGGGGPLRLVGMNGDLMSQYIEFVADRLLMA                    LGCKKMYNVANPFDWMELISLQGKTNFFEKRVGDYQKASVMSSLNGGASANHVFSIDE                    DF</aaseq>|
 
DNA = <dnaseqindica>841..1091#2..239#cccacgccgccgccgccgaatccccacaaccccaaatccccatccagaaaccaccccgatccgcgacgaagatgccggccgcgccgacgctggtgcccgcctgcgacctggaggagccgctgctggcggagtcgtccgagcgattctcgatgttcccgatcaggtacccgcagatctgggagttctacaagaaggcggtggcgtcgttctggacggcggaggaggtggacctctccgccgacgcgcgccactgggacgccgcgctgtcccccgacgagcgccacttcatctcccacgtgctcgccttcttcgccgcctccgacggcatcgtgctcgagaacctcgcctccaggttcatgtccgacgtgcaggtcgccgaggcgcgcgccttctacggattccagatcgccatcgagaacatccactctgagatgtactcgctgctgctcgagacctacatccgcgacggcgccgagaaggaccggctgttccgcgccatcgacaccgtcccggccgtgcgccgcaaggccgactgggccatgcgctggatcgacggcggcgagcgcttcgccgagcgcctcgtcgccttcgcctgcgtcgaggggatcttcttctcgggctccttctgcgccatcttctggctcaagaagcgggggctcatgccgggcctcaccttctccaacgagctcatctcccgcgacgagggcctgcactgcgacttcgcctgcctcctctacgacctcctccgcggcaagctcgacgaggcgcgcgtccgcgagatcgtcgccgacgccgtcgacatcgagagggagttcgtctgcgacgcgctccccgtcgcgctcgtcggcatgaacggcgacctcatgagccagtacatcgagttcgtcgccgaccgcctcctcatggcgctcggctgcaagaagatgtacaacgtcgctaaccccttcgactggatggagctcatatccctgcagggcaagaccaacttcttcgagaagcgcgtcggcgactaccagaaggcgtccgtcatgtcgagcctcaacggcggcgcctccgccaaccacgtcttcagcatcgacgaagacttctgatttgccaatctcctcgtgtacatctccaaccctcgcagtcacttgctctctgcccccccttactagtagtagtagtaatacatgcgcgtggtgctccctaatgttatagttggtgtgttgctggttcttgttggtgatgtatcctaatgaattatgaatccagttgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187771.1 RefSeq:Os06g0257450]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 6]]
 
[[Category:Chromosome 6]]
 

Latest revision as of 07:30, 10 December 2016

The rice gene Os06g0257450 was reported as st1 in 2009[1] by researchers from USA and Japan.

Annotated Information

Gene Symbol

  • Os06g0257450 <=> st1(ws1), ws1, st1, RNRS1, rnrs1

Function

  • V3 and St1, which encode the large and small subunits of ribonucleotide reductase (RNR), RNRL1, and RNRS1, respectively. RNR regulates the rate of deoxyribonucleotide production for DNA synthesis and repair.
  • The researchers found that the chlorotic phenotypes of v3 and st1 mutants are conditionally developed by missense mutations in the RNR subunits demonstrates that chloroplast biogenesis is arrested when plants fail to satisfy an increased requirement of RNR activity, particularly under restrictive temperatures or during the most active growth period (tillering stage).

Mutation

  • The virescent3 (v3) and stripe1 (st1) mutants in rice (Oryza sativa) produce chlorotic leaves in a growth stage-dependent manner under field conditions. They are temperature-conditional mutants that produce bleached leaves at a constant 20℃ or 30℃ but almost green leaves under diurnal 30℃/20℃ conditions.

Expression

Evolution

You can also add sub-section(s) at will.

Labs working on this gene

  • Section of Plant Biology, College of Biological Sciences, University of California, Davis, CA 95616.
  • Present address: Biotechnology Laboratory, Toyota Central R&D Labs, Inc., Nagakute, Aichi 480¨C1192, Japan.

References

  1. Yoo SC, Cho SH, Sugimoto H, Li J, Kusumi K, Koh HJ, Iba K, Paek NC. Rice virescent3 and stripe1 encoding the large and small subunits of ribonucleotide reductase are required for chloroplast biogenesis during early leaf development. Plant Physiol. 2009 May;150(1):388-401. doi: 10.1104/pp.109.136648. PubMed PMID: 19297585; PubMed Central PMCID: PMC2675711.


Structured Information