Difference between revisions of "Os09g0410500"

From RiceWiki
Jump to: navigation, search
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os09g0410500 was reported as '''''REP1''''' in 2009<ref name="ref1" /> by researchers from China and UK.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os09g0410500 <=> REP1, OsTCP24, REP1, TCP24, SDP1
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Floral zygomorphy along the lemma-palea axis in rice (Oryza sativa) is partially or indirectly determined by the '''''CYCLOIDEA (CYC)'''''-like homolog '''''RETARDED PALEA1 (REP1)''''', which regulates palea identity and development.
  
===Expression===
+
===Mutation===
Please input expression information here.
+
* The development of palea is significantly retarded in the '''''rep1''''' mutant and its palea has five vascular bundles, which is similar to the vascular pattern of the wild-type lemma.
 +
* Furthermore, ectopic expression of '''''REP1''''' caused the asymmetrical overdifferentiation of the palea cells, altering their floral asymmetry.
 +
 
 +
===Expression ===
 +
* The '''''REP1''''' gene is only expressed in palea primordium during early flower development, but during later floral stages is radially dispersed in stamens and the vascular bundles of the lemma and palea.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China (Z.Y., S.G., L.-T.L., S.-Y.D., X.Y., D.-B.Z.);
 +
* State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, China (D.-W.X., Q.Q.); Key Laboratory of Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Graduate School of the Chinese Academy of Sciences, Shanghai 200032, China (D.L.);
 +
* Plant Sciences Division, School of Biosciences, University of Nottingham, Loughborough, Leicestershire LE12 5RD, United Kingdom (Z.A.W.)
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Yuan Z, Gao S, Xue DW, Luo D, Li LT, Ding SY, Yao X, Wilson ZA, Qian Q, Zhang
 +
DB. RETARDED PALEA1 controls palea development and floral zygomorphy in rice.
 +
Plant Physiol. 2009 Jan;149(1):235-44. doi: 10.1104/pp.108.128231. PubMed PMID:
 +
18952859; PubMed Central PMCID: PMC2613737.
 +
</ref>
 +
</references>
  
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]
GeneName = Os09g0410500|
 
Description = Similar to SfCYC2 protein (Fragment)|
 
Version = NM_001069684.2 GI:297609459 GeneID:4347031|
 
Length = 1579 bp|
 
Definition = Oryza sativa Japonica Group Os09g0410500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:15221003..15222581|
 
CDS = 15221003..15221717,15222520..15222581|
 
GCID = <gbrowseImage1>
 
name=NC_008402:15221003..15222581
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:15221003..15222581
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgcagcagcagctggatcagcagcagcagcagcagcagcatcagtacgaccacttcttctccggccacggccagttcaactccgagacgctggaggccgtgctctgcaggccgccgcgcggcgccgccgcggatcctgctgttccggcggcggcggcggcggcggctgttctgacggcggcaagaaacggtggcggcggccatggcagggcgaggaagcggccgttcaggacggaccggcacagcaagatccggacggcgcagggggtgcgcgaccgccggatgcggctgtcgctcgacgtcgcgcgcgacttcttcgcgctgcaggaccgcctcggcttcgacaaggccagcaagacggtggactggctgctcacccagtccaagccggccatcgaccgcctcgccgccgacccctcctcctcctcccaccgcgccgccggcgacacccgcatgtcgtcggccgagcgcggcggcgatcaccacatggtcgcggtcggcgccgccggatcagggaaaggagacgcggacaaggcgaggggccccagaggtggtagatcggcgcccatggagctcggctgcgagctcggccgcctcgtgccggcgccggtgctcggcgagtactactacgagctcgccgagatgatgagcaacaacaccggaggagaaggagacgacgacggcgactacgacgacgacggcgatttcttggacgactctgggtttctctgccactatcgatcgaagaagaaatttagcataaaggacatttcttaa</cdnaseq>|
 
AA = <aaseq>MQQQLDQQQQQQQHQYDHFFSGHGQFNSETLEAVLCRPPRGAAA                    DPAVPAAAAAAAVLTAARNGGGGHGRARKRPFRTDRHSKIRTAQGVRDRRMRLSLDVA                    RDFFALQDRLGFDKASKTVDWLLTQSKPAIDRLAADPSSSSHRAAGDTRMSSAERGGD                    HHMVAVGAAGSGKGDADKARGPRGGRSAPMELGCELGRLVPAPVLGEYYYELAEMMSN                    NTGGEGDDDGDYDDDGDFLDDSGFLCHYRSKKKFSIKDIS</aaseq>|
 
DNA = <dnaseqindica>1..715#1518..1579#atgcagcagcagctggatcagcagcagcagcagcagcagcatcagtacgaccacttcttctccggccacggccagttcaactccgagacgctggaggccgtgctctgcaggccgccgcgcggcgccgccgcggatcctgctgttccggcggcggcggcggcggcggctgttctgacggcggcaagaaacggtggcggcggccatggcagggcgaggaagcggccgttcaggacggaccggcacagcaagatccggacggcgcagggggtgcgcgaccgccggatgcggctgtcgctcgacgtcgcgcgcgacttcttcgcgctgcaggaccgcctcggcttcgacaaggccagcaagacggtggactggctgctcacccagtccaagccggccatcgaccgcctcgccgccgacccctcctcctcctcccaccgcgccgccggcgacacccgcatgtcgtcggccgagcgcggcggcgatcaccacatggtcgcggtcggcgccgccggatcagggaaaggagacgcggacaaggcgaggggccccagaggtggtagatcggcgcccatggagctcggctgcgagctcggccgcctcgtgccggcgccggtgctcggcgagtactactacgagctcgccgagatgatgagcaacaacaccggaggagaaggagacgacgacggcgactacgacgacgacggcgatttcttggacggtatgcaatattagcttcagctagcttagcttgcttgcttgcatggtttctcctctagctagtagcagcttaattagctagcttataagcagcttgattgattgattaggtcttgatctgctactctgcccagcatttcagcgcttctagttgttaattaatttgcatgtgtacttagtactatgtcgactaatcttatggtttcatgcagctctttaattttaatttctcgcttttgcttatctgtctaagctttgtaagatttggcttgatttgtttgtttggtgttttcaatttaggagagattagtaagcttaattaattttgtcttgaagtagtcgtcatatatatggttaattagctagctatagctagagagttgttgacttggtcgtgttgactgcatacggatctctcatgagatgacaactgattgcgtgtgaagataatcgtttagttaaatgattccaagatttggttcagcaaggatatgatgtgacagcatggcgtacatgtattattcaggtaagagtaacagtacttgaaaagtatccaattatccatacaagtgatgaaattaaaccaaaatggacaatttgaaactatatatgcttcttgtgggttgtgaggtgataggcaaatgagtcttgtttcgatccttccatgaactcaaaatccgtcactataaaggaaagaagagaaaattcacatattaatataatttaacttcaatatgtacgacaataattttaaaaattcactcctgttcaaaaccttgggattaattaacttcattgttcagactctgggtttctctgccactatcgatcgaagaagaaatttagcataaaggacatttcttaa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069684.2 RefSeq:Os09g0410500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 9]]
 
[[Category:Chromosome 9]]
 

Latest revision as of 12:40, 11 December 2016

The rice gene Os09g0410500 was reported as REP1 in 2009[1] by researchers from China and UK.

Annotated Information

Gene Symbol

  • Os09g0410500 <=> REP1, OsTCP24, REP1, TCP24, SDP1

Function

  • Floral zygomorphy along the lemma-palea axis in rice (Oryza sativa) is partially or indirectly determined by the CYCLOIDEA (CYC)-like homolog RETARDED PALEA1 (REP1), which regulates palea identity and development.

Mutation

  • The development of palea is significantly retarded in the rep1 mutant and its palea has five vascular bundles, which is similar to the vascular pattern of the wild-type lemma.
  • Furthermore, ectopic expression of REP1 caused the asymmetrical overdifferentiation of the palea cells, altering their floral asymmetry.

Expression

  • The REP1 gene is only expressed in palea primordium during early flower development, but during later floral stages is radially dispersed in stamens and the vascular bundles of the lemma and palea.

Evolution

You can also add sub-section(s) at will.

Labs working on this gene

  • School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China (Z.Y., S.G., L.-T.L., S.-Y.D., X.Y., D.-B.Z.);
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, China (D.-W.X., Q.Q.); Key Laboratory of Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Graduate School of the Chinese Academy of Sciences, Shanghai 200032, China (D.L.);
  • Plant Sciences Division, School of Biosciences, University of Nottingham, Loughborough, Leicestershire LE12 5RD, United Kingdom (Z.A.W.)

References

  1. Yuan Z, Gao S, Xue DW, Luo D, Li LT, Ding SY, Yao X, Wilson ZA, Qian Q, Zhang DB. RETARDED PALEA1 controls palea development and floral zygomorphy in rice. Plant Physiol. 2009 Jan;149(1):235-44. doi: 10.1104/pp.108.128231. PubMed PMID: 18952859; PubMed Central PMCID: PMC2613737.


Structured Information