|
|
| (2 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os11g0684000''' was reported as ''' OsMPK5''' in 2010 <ref name="ref1" /> by researchers from the USA. |
| − | | + | <br> |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''Os11g0684000 <=> OsMPK5''' |
| | + | <br> |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | *These data favor a model whereby exogenous ABA enhances resistance against C. miyabeanus at least in part by suppressing pathogen-induced ET action in an '''OsMPK5'''-dependent manner. |
| − | | + | <br> |
| − | ===Expression===
| |
| − | Please input expression information here.
| |
| − | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | *Exogenous ethephon application enhances susceptibility, whereas genetic disruption of ET signaling renders plants less vulnerable to C. miyabeanus attack, thereby inducing a level of resistance similar to that observed on ABA-treated wild-type plants. Moreover, ABA treatment alleviates C. miyabeanus-induced activation of the ET reporter gene EBP89, while derepression of pathogen-triggered EBP89 transcription via RNA interference-mediated knockdown of '''OsMPK5''',an ABA-primed mitogen-activated protein kinase gene, compromises ABA-IR. |
| − | | + | <br> |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *Laboratory of Phytopathology, Faculty of Bioscience Engineering, Ghent University, B–9000 Ghent, Belgium (D.D.V., M.H.); |
| − | | + | *Department of Plant Pathology and Huck Institutes of Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802 (Y.Y.); |
| | + | *Plant Breeding, Genetics, and Biotechnology Division, International Rice Research Institute, 1099 Manila, Philippines (C.V.C.) |
| | + | <br> |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1"> |
| | + | Abscisic Acid-Induced Resistance against the Brown Spot Pathogen Cochliobolus miyabeanus in Rice Involves MAP Kinase-Mediated Repression of Ethylene Signaling |
| | + | </ref> |
| | | | |
| | + | </references> |
| | + | <br> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]] |
| − | GeneName = Os11g0684000|
| |
| − | Description = Similar to Transcription factor MYB21 (Myb-related protein 21) (AtMYB21) (Myb homolog 3) (AtMyb3)|
| |
| − | Version = NM_001074998.2 GI:297612394 GeneID:4351131|
| |
| − | Length = 3014 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os11g0684000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
| |
| − | AP = Chromosome 11:29513029..29516042|
| |
| − | CDS = 29513430..29513973,29514967..29515096,29515716..29515899|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008404:29513029..29516042
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008404:29513029..29516042
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggagatggtgctgcagaggacgagccaccacccggtgcccggggagcagcaggaggcggcggcggagctgtcgtcggctgagctccggcgagggccgtggaccgtcgatgaggacctcaccctcatcaattacatctctgatcacggcgagggccgctggaacgcactcgcacgcgccgccggtctgaagaggactgggaagagctgccggctccggtggctgaactatctccggccggatgtgaagcgcggcaacttcaccgcagaggagcagctgctcatcctcgacctccactcccgatggggcaaccgatggtccaagatagcacaacatttgcctgggaggaccgacaacgagatcaagaactactggaggaccagagtgcaaaagcatgccaagcaactcaattgtgatgtcaacagcaagaggttcaaggatgccatgaagtacctatggatgcctcgccttgccgagcgcatccatgccagggctggcgctgttgatgatagcggagactacagcaacaacgacttatcatgtgtatctggtgtaacaatggccactgttgctaattgttttgatggctctccgagcatggtgactagctcatcttccgattcgttcacgtcggagtcacaagatttgaagaagattaacttacatgtgcatggtgatgatgagaagatgaactctgaagactggatgcaggaggtggaccatgagttttggtctacagagattcagcctaataatgaacagtttcaggaccaacagcttaacggttgggtgcaaggtttttctgagggtttgtccgaaactctatggagtctagaggacatatggaagatgcaataa</cdnaseq>|
| |
| − | AA = <aaseq>MEMVLQRTSHHPVPGEQQEAAAELSSAELRRGPWTVDEDLTLIN YISDHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRGNFTAEEQLLILDLHSRW GNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLNCDVNSKRFKDAMKYLWMPRLAER IHARAGAVDDSGDYSNNDLSCVSGVTMATVANCFDGSPSMVTSSSSDSFTSESQDLKK INLHVHGDDEKMNSEDWMQEVDHEFWSTEIQPNNEQFQDQQLNGWVQGFSEGLSETLW SLEDIWKMQ</aaseq>|
| |
| − | DNA = <dnaseqindica>2070..2613#947..1076#144..327#agctgcacccttgcatcttctctctctctctcttcttcttcttcttcttctccatatctcctactcctcgtgaagatcgatcgaccatcggcaatttcattcggtaatagttaagctaagatcaaatcaagattggcgaaacgatggagatggtgctgcagaggacgagccaccacccggtgcccggggagcagcaggaggcggcggcggagctgtcgtcggctgagctccggcgagggccgtggaccgtcgatgaggacctcaccctcatcaattacatctctgatcacggcgagggccgctggaacgcactcgcacgcgccgccggtaagcttctatacctcttatactgccagtaaattgtaccgtaaaagttgtctttgtcgaaaacactagctacttagctgtttaattaacttcgattaactcaaattatcaaaatttctcaatccgcaactccgcaaggtatagctaagatatatacacgtaaatttaattacgctttaattaccagcagagaaaaaaagaaagctaggtatgcatgagcagtgggattaataattaattgggttgggagaattaagcagcaaacttaaccaacaacctgtttatagagtaggttagccaggacagaattttcctttccagtgcagcttagccggcgacgtcagtcacgagtccaatcatttcctccactacctgtcttcaaaactatgtgcgcctccgaccacataattaatcactatagccatgcacagttatcacaaattaaccaatctctcacacaactgttgattaattgtaacctagccatcacgccatgtgtctcacaacatgtactactactccaactaatgagtcaatcaattaatcaactgtgagatggatgctgattaatagtggagagagagagattattgatgaaattttaattgtgcatatataggtctgaagaggactgggaagagctgccggctccggtggctgaactatctccggccggatgtgaagcgcggcaacttcaccgcagaggagcagctgctcatcctcgacctccactcccgatggggcaaccggtaataatcaattaattaattagctcactcgtcattaattaatcttatagaatctagtattcatgcatagatcagaaatgttctcagctacttcctctgtatttttaatatatgacggcattaattcttattataacctttgatcattcatcttattaaaaaaattatacaaatcttaaaaatataagtaatagttaaagttcattaccgataaatcaagccacacggccacaacaaaagaaaatatatttgcttaaatttttactgataaatcaaacataatgtaaaaagtgaacaacataatatattagaagacggaggcactatcgttctaatctaattggctgacttcagtgaagctttcattaacttatagtagtcattaactaattaaatcccttcttaagacctgctaattaaccaccatgctcaccatccagcaaacctcgaggcgacacgtgtcctacactgtagagaagaatgaagactagcttagcttagcttagattaattagctgggagcttaatttgacgcctcgtgatgcagattagactcgtgtagacgccgctagcaagctaagctaaaagtaaaggaaggacatgtcacggtcgtacagacttgtgacgtggacgtgacgtggacttggccgctctcaacacatgtcaactcgtccctgccatgtacaaacgcacgtacgtgacgtgacacactaattcacacactttcagaattttaatcagccaacaatggccggctaattttattcccctgtgcacaaagaaacgcatgcatcgctgacactgaaagatgtaccaccagtttggaatttgcacgcctcctctcttctcatttctacacttgtatgtttgtgtccacccatccatcttaattccttttttttgctcttagcatatttgcactttggttcacaccttggtaacataattagatgtgtgggtttctcatttggtcaattattattgaaactacagatggtccaagatagcacaacatttgcctgggaggaccgacaacgagatcaagaactactggaggaccagagtgcaaaagcatgccaagcaactcaattgtgatgtcaacagcaagaggttcaaggatgccatgaagtacctatggatgcctcgccttgccgagcgcatccatgccagggctggcgctgttgatgatagcggagactacagcaacaacgacttatcatgtgtatctggtgtaacaatggccactgttgctaattgttttgatggctctccgagcatggtgactagctcatcttccgattcgttcacgtcggagtcacaagatttgaagaagattaacttacatgtgcatggtgatgatgagaagatgaactctgaagactggatgcaggaggtggaccatgagttttggtctacagagattcagcctaataatgaacagtttcaggaccaacagcttaacggttgggtgcaaggtttttctgagggtttgtccgaaactctatggagtctagaggacatatggaagatgcaataaattttacatttacaaaggacatatttgtaaaatagaatagagagacatcaaggaaggcaaagagaaaaagttctttagtcatatactgtacgttgagacacttaagttctttgccaacttcaatgttttttttcttttatttttgctgcctctttcgatccctgaaggggtttttgccttctagatgtctaggggttcaaagaggaccagaggagatatatatgtgtttggatatgttgatatatgagctgatatatgccttactatatatatactccagaattgcactgaggattacatatccaattcagacatgcaaaccttaccagttgcaatattgtaaattacatgtccaattttgtagtttcatcttcctcatcataaaaaaattatgttgtgtc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074998.2 RefSeq:Os11g0684000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 11]]
| |
| − | [[Category:Chromosome 11]]
| |
