|
|
| (3 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os02g0542400''' was reported as ''' osgtgamma-1''' in 2010 <ref name="ref1" /> by researchers from the China. |
| − | | + | <br> |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''Os02g0542400 <=> osgtgamma-1''' |
| | + | <br> |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | *'''OsGTc''' subfamily may participate in the regulation of stress tolerance in rice. |
| − | | + | <br> |
| − | ===Expression=== | + | ===Mutana=== |
| − | Please input expression information here.
| + | *A homozygous mutant '''osgtc-1''' (with T-DNA inserted in the promoter region of OsGTc-1) showed more sensitive to salt stress than wild-type rice. Overexpression of OsGTc-1 in rice enhanced salt tolerance at the seedling stage. |
| − | | + | <br> |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *National Key Laboratory of Crop Genetic Improvement,National Center of Plant Gene Research (Wuhan),Huazhong Agricultural University, 430070 Wuhan, China |
| − | | + | <br> |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1"> |
| | + | Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses |
| | + | </ref> |
| | | | |
| | + | </references> |
| | + | <br> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0542400|
| |
| − | Description = Conserved hypothetical protein|
| |
| − | Version = NM_001053603.1 GI:115446576 GeneID:4329598|
| |
| − | Length = 2138 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0542400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:21005728..21007865|
| |
| − | CDS = 21006344..21007576|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:21005728..21007865
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:21005728..21007865
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggaggggaatttgccgccgagaggagcccttgtccatggccatggcggcggcgtcggcgccttcgatctggaggcgacgatgcagccgccgccgccgttccacttcgcccaggatccgcacctccaccaccaccagggcatggtccccgtccgcgggaacccgatgctggatttgggcaatgtggtcaagacctcgccgagcgacgaggaggacgtggatgacggccaccaccatggtggcggcggcggcagcggtaaggaggcctcccagtggcaccgggtgaagtggatcagtggcatggtcaagctgctggtgtccgccgtggcctacatcgacgaggacgtcgacatggactacggcacgggcagcgccgcgaggaggaagcacgccatgctgaagaggaaggggaagtggaggctcgtctccgcggcgatgaccgagaggggcttcccggtgtcgccgcagcagtgcgaggacaagttcaacgatctcaacaagaggtacaagaggatgaccgagatccttggccggggaacggcgtgccaggtcgtcgagcaccccgagcttcttgaagggatgcggctctcgggaaagctcaaagaggaggctaggaagcacctgaactcaaagcatctgcactatgaggagatgtgctcgtaccataacaggaacaaaatgtgtctgtttgatgatcccgcccttcagaagtcattgcgtttggcgcttaggagtggagaggagcatgcaaagaagaacccgtttgggtatgatgatgaggatttttctgacgatgacgacgaagatgaagaattcgatgatctggaggtcagcgctgaagatcatcaccatggaattcatggtgccaagaggctgaagcatgatcaggaggagacgcattttgggtctaatctgtcagaagttgctgttattgacatgaacaaaatgctctctgagggatctggtggtccaactgctgaaaagagtccctctacccctggtatgcgtgatattcgacttgaaaaacgccgcctgaagatcaaagctcagatgctgaaaattgagcagaagcatttcaagtggctgaggttcagcaaggagaaggacagggaattggagaagatgagactggagaatgaaaagatgaaactggagaatgagcggttggaattggagctgaagcttaaagaaatagagatgggtatcaaaccaaagaagatttttagtgattga</cdnaseq>|
| |
| − | AA = <aaseq>MEGNLPPRGALVHGHGGGVGAFDLEATMQPPPPFHFAQDPHLHH HQGMVPVRGNPMLDLGNVVKTSPSDEEDVDDGHHHGGGGGSGKEASQWHRVKWISGMV KLLVSAVAYIDEDVDMDYGTGSAARRKHAMLKRKGKWRLVSAAMTERGFPVSPQQCED KFNDLNKRYKRMTEILGRGTACQVVEHPELLEGMRLSGKLKEEARKHLNSKHLHYEEM CSYHNRNKMCLFDDPALQKSLRLALRSGEEHAKKNPFGYDDEDFSDDDDEDEEFDDLE VSAEDHHHGIHGAKRLKHDQEETHFGSNLSEVAVIDMNKMLSEGSGGPTAEKSPSTPG MRDIRLEKRRLKIKAQMLKIEQKHFKWLRFSKEKDRELEKMRLENEKMKLENERLELE LKLKEIEMGIKPKKIFSD</aaseq>|
| |
| − | DNA = <dnaseqindica>617..1849#ttcttcctttctctgtgtttgtttgtttccagttgccactaaccagccagagccccgggggggagaagagcgagagaggaggagaaatcttgcagcaatccctcgcttagattcgccattaccgccgcttttgttcccaccaagattaccaccccctcctcctcctgtgctcgagcgctcgcatcgcatttcaggctgcttcttgattctgcgaggaggttgaaatctctcgtggtatgatctgatttcgggttgattttcgtcacgcggtggattccttccccccaacactattccggtgccaacccttttttgttttttgtttttttttgtggctgttcttggcgtcgcctctactggcttcttgccgtgctgcagattgcaacagctgccatccgttcgttccggtggagtgcaccccttcatcaccaaggaggagaaaaagctgtaatcttcggccgtttctgcctttctgcagcaaacggttgaagaaaagccgcgtcttttgggcggatttcgcggaggccgcttgaggtttttaggcgtggttcgtgtgagcttctctttggaatttgtgggggaaagagtgagggagggagggagctcagtgggagagatggaggggaatttgccgccgagaggagcccttgtccatggccatggcggcggcgtcggcgccttcgatctggaggcgacgatgcagccgccgccgccgttccacttcgcccaggatccgcacctccaccaccaccagggcatggtccccgtccgcgggaacccgatgctggatttgggcaatgtggtcaagacctcgccgagcgacgaggaggacgtggatgacggccaccaccatggtggcggcggcggcagcggtaaggaggcctcccagtggcaccgggtgaagtggatcagtggcatggtcaagctgctggtgtccgccgtggcctacatcgacgaggacgtcgacatggactacggcacgggcagcgccgcgaggaggaagcacgccatgctgaagaggaaggggaagtggaggctcgtctccgcggcgatgaccgagaggggcttcccggtgtcgccgcagcagtgcgaggacaagttcaacgatctcaacaagaggtacaagaggatgaccgagatccttggccggggaacggcgtgccaggtcgtcgagcaccccgagcttcttgaagggatgcggctctcgggaaagctcaaagaggaggctaggaagcacctgaactcaaagcatctgcactatgaggagatgtgctcgtaccataacaggaacaaaatgtgtctgtttgatgatcccgcccttcagaagtcattgcgtttggcgcttaggagtggagaggagcatgcaaagaagaacccgtttgggtatgatgatgaggatttttctgacgatgacgacgaagatgaagaattcgatgatctggaggtcagcgctgaagatcatcaccatggaattcatggtgccaagaggctgaagcatgatcaggaggagacgcattttgggtctaatctgtcagaagttgctgttattgacatgaacaaaatgctctctgagggatctggtggtccaactgctgaaaagagtccctctacccctggtatgcgtgatattcgacttgaaaaacgccgcctgaagatcaaagctcagatgctgaaaattgagcagaagcatttcaagtggctgaggttcagcaaggagaaggacagggaattggagaagatgagactggagaatgaaaagatgaaactggagaatgagcggttggaattggagctgaagcttaaagaaatagagatgggtatcaaaccaaagaagatttttagtgattgaagccttggaatgatagaactagaaatggttagagttgctggtgatccttttgtcttttgcaggagcttgcagatttagggtcttatatatacattgatctgtgcccctgtttgaattttaccttagctaactgcaatcggtcaagtgaatggctattccagttgttaagtgtttaaacttggtactagttggcctttcaaatgataaatgtttaagccgtccttgtacatgcctgctgttaactttctgcagttgtttgtgtgttgctattgacctctgagtctttttt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053603.1 RefSeq:Os02g0542400]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
