Difference between revisions of "Os09g0488000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os09g0488000| Description = GCN5-related N-acetyltransferase domain containing protein| Version = NM_001070065.1 GI:115479872 GeneID:4347432| Le...")
 
(Function)
 
(5 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice gene Os09g0488000 was reported as '''''OsGNA1''''' in 2005<ref name="ref1" /> by researchers from China.
GeneName = Os09g0488000|
 
Description = GCN5-related N-acetyltransferase domain containing protein|
 
Version = NM_001070065.1 GI:115479872 GeneID:4347432|
 
Length = 737 bp|
 
Definition = Oryza sativa Japonica Group Os09g0488000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os09g0488000 <=> OsGNA1, GNA1
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
+
* '''''OsGNA1''''' gene encodes a glucosamine-6-P acetyltransferase (designated OsGNA1), which is involved in de novo UDPN- acetylglucosamine biosynthesis. Protein glycosylation plays a key role in cell metabolism, microtubule stabilization, and cell shape in rice roots.
AP = Chromosome 9:19479227..19479963|
+
 
CDS = 19479466..19479963|
+
===Mutation===
GCID = <gbrowseImage1>
+
* '''''gna1''''' mutant exhibits a temperature-sensitive defect in root elongation was isolated.
name=NC_008402:19479227..19479963
+
 
source=RiceChromosome09
+
* The aberrant root morphology of the '''''gna1''''' mutant includes shortening of roots, disruption of microtubules, and shrinkage of cells in the root elongation zone.
preset=GeneLocation
+
===Expression ===
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
===Evolution===
name=NC_008402:19479227..19479963
+
 
source=RiceChromosome09
+
You can also add sub-section(s) at will.
preset=GeneLocation
+
==Labs working on this gene==
</gbrowseImage2>|
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310029, People’s Republic of China
CDNA = <cdnaseq>atggaacagccgctccccaccgccgcggcggaggcggccgccgccggcggcgacggcgaggcctaccggatccggccgctggagctcgccgacatctccagggggtttctgggcctcctcaaccagctctccccctcgccgcccctcacggaggaggccttccgcgcgcggttcgaggagctcgcggcgctgggcgccgaccacctcgtcctcgtcgcggaggacgccgccacgggccgcctcgccgccgcgggggccgtgctcgtggagcgcaagttcatacggcggtgcggccgggtggggcacgtcgaggacgtcgtggtggacgccgccgcgcgcggccgcgggctcggggagcgcgtcgtgcgccgcctcgtggagcacgcgagggggaggggttgctacaaggtcatcatcaactgcaccccggagctgacggggttctacgccaagtgcgggttcgtggagaagaacgtccagatggggctctacttctga</cdnaseq>|
+
==References==
AA = <aaseq>MEQPLPTAAAEAAAAGGDGEAYRIRPLELADISRGFLGLLNQLS                    PSPPLTEEAFRARFEELAALGADHLVLVAEDAATGRLAAAGAVLVERKFIRRCGRVGH                    VEDVVVDAAARGRGLGERVVRRLVEHARGRGCYKVIINCTPELTGFYAKCGFVEKNVQ                    MGLYF</aaseq>|
+
<references>
DNA = <dnaseqindica>1..498#atggaacagccgctccccaccgccgcggcggaggcggccgccgccggcggcgacggcgaggcctaccggatccggccgctggagctcgccgacatctccagggggtttctgggcctcctcaaccagctctccccctcgccgcccctcacggaggaggccttccgcgcgcggttcgaggagctcgcggcgctgggcgccgaccacctcgtcctcgtcgcggaggacgccgccacgggccgcctcgccgccgcgggggccgtgctcgtggagcgcaagttcatacggcggtgcggccgggtggggcacgtcgaggacgtcgtggtggacgccgccgcgcgcggccgcgggctcggggagcgcgtcgtgcgccgcctcgtggagcacgcgagggggaggggttgctacaaggtcatcatcaactgcaccccggagctgacggggttctacgccaagtgcgggttcgtggagaagaacgtccagatggggctctacttctgaattctgatctaggtttcgtcttcttggatctctctgcctactacttgttgtacttagttaataaggaattttatgtcagttattgctccttgtatggatggatggatcactgatcaatgtggctaattccatttgcattgccaagatgtgcaagtttatttaattgaatggattgttctctgcatttatgtgcaaatctcattcttgcaaatgatttcaatgagtaaaagtaccataat</dnaseqindica>|
+
* <ref name="ref1">
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070065.1 RefSeq:Os09g0488000]|
+
Jiang H, Wang S, Dang L, Wang S, Chen H, Wu Y, Jiang X, Wu P. A novel
}}
+
short-root gene encodes a glucosamine-6-phosphate acetyltransferase required for
[[Category:Genes]]
+
maintaining normal root cell shape in rice. Plant Physiol. 2005
[[Category:Japonica mRNA]]
+
May;138(1):232-42. PubMed PMID: 15849305; PubMed Central PMCID: PMC1104178.
[[Category:Oryza Sativa Japonica Group]]
+
 
[[Category:Japonica Genes]]
+
</ref>
[[Category:Japonica Chromosome 9]]
+
</references>
[[Category:Chromosome 9]]
+
 
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]

Latest revision as of 07:23, 12 December 2016

The rice gene Os09g0488000 was reported as OsGNA1 in 2005[1] by researchers from China.

Annotated Information

Gene Symbol

  • Os09g0488000 <=> OsGNA1, GNA1

Function

  • OsGNA1 gene encodes a glucosamine-6-P acetyltransferase (designated OsGNA1), which is involved in de novo UDPN- acetylglucosamine biosynthesis. Protein glycosylation plays a key role in cell metabolism, microtubule stabilization, and cell shape in rice roots.

Mutation

  • gna1 mutant exhibits a temperature-sensitive defect in root elongation was isolated.
  • The aberrant root morphology of the gna1 mutant includes shortening of roots, disruption of microtubules, and shrinkage of cells in the root elongation zone.

Expression

Evolution

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310029, People’s Republic of China

References

  1. Jiang H, Wang S, Dang L, Wang S, Chen H, Wu Y, Jiang X, Wu P. A novel short-root gene encodes a glucosamine-6-phosphate acetyltransferase required for maintaining normal root cell shape in rice. Plant Physiol. 2005 May;138(1):232-42. PubMed PMID: 15849305; PubMed Central PMCID: PMC1104178.


Structured Information