Difference between revisions of "Os02g0190600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0190600| Description = Lycopene cyclase, beta and epsilon family protein| Version = NM_001052686.2 GI:297598739 GeneID:4328572| Length = 11...")
 
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''Os02g0190600''' was reported as ''' b-OsLCY''' in 2008 <ref name="ref1" /> by researchers from the China.
GeneName = Os02g0190600|
+
<br>
Description = Lycopene cyclase, beta and epsilon family protein|
+
==Annotated Information==
Version = NM_001052686.2 GI:297598739 GeneID:4328572|
+
===Gene Symbol===
Length = 1106 bp|
+
*'''Os02g0190600 <=> b-OsLCY'''
Definition = Oryza sativa Japonica Group Os02g0190600, complete gene.|
+
<br>
Source = Oryza sativa Japonica Group
+
===Function===
 +
*Lycopene b-cyclase ('''b-OsLCY'''), which are essential for the biosynthesis of carotenoid precursors of ABA.
 +
*The impairment of carotenoid biosynthesis causes photo-oxidation and ABA-deficiency phenotypes, of which the latter is a major factor controlling the PHS trait in rice.
 +
<br>
 +
===Mutant===
 +
*'''OsLCY''' RNAi transgenic rice indicated that photo-oxidative damage occurred in PS II, consistent with the accumulation of ROS in these plants.
 +
<br>
 +
==Labs working on this gene==
 +
*State Key Laboratory of Plant Genomics and National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences (CAS), Beijing 100101, China,
 +
*Graduate University of the CAS, Beijing 100039, China,
 +
*State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China,
 +
*Centre for Biological Electron Microscopy, Institute of Biophysics, CAS, Beijing 100101, China,
 +
*State Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, CAS, Beijing 100093, China,
 +
*National Centre for Gene Research, CAS, Shanghai 200233, China, and
 +
*Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, CAS, Beijing 100101,China
 +
<br>
 +
==References==
 +
<references>
 +
<ref name="ref1">
 +
Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
 +
</ref>
  
  ORGANISM  Oryza sativa Japonica Group
+
</references>
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
<br>
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
==Structured Information==
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:5028608..5029713|
 
CDS = 5028910..5029713|
 
GCID = <gbrowseImage1>
 
name=NC_008395:5028608..5029713
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:5028608..5029713
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>caggtcgcctatggcatcctcgccgaggtggacggacacccgttcgacatcgacaagatgctgttcatggactggcgcgacgcgcacctccccgaggggtccgagatcagggagcgcaaccgccgcatcccgacgttcctctacgccatgcccttctccccgacgaggatcttcctcgaggagacctccctcgtggcgcgcccgggcctcgccatggacgacatccaggagcgcatggcggcgaggctgcgccacctcgggatacgcgtccgcgccgtggaggaggacgagcggtgcgtcatccccatgggcggcccgctcccggtgctcccgcagcgggtcgtcggcatcggcggcaccgccgggatggtgcacccgtccacgggctacatggtggcgcgcaccctcgccactgcgcccatcgtggcggacgccatcgtgcgcttcctcgacaccggcagcggcgacagcgcgttcgccggcgacgcgctgtcggcggaggtgtggagggagctgtggccggcgcagaggaggaggcagagggagttcttctgcttcggcatggacatcctcctcaagctcgacctcgacggcacgcggcgattcttcgacgccttcttcgacctggagccgcgctactggcacggcttcctgtcgtcgaggctcttcttgccggagctcgccatgttcggcctctccctcttcgccaaggcctccaacacgtcgcgcctcgagatcatggccaagggcaccgcccctctcgccaagatgatcggcaacctcatccaggacagagataggtga</cdnaseq>|
 
AA = <aaseq>QVAYGILAEVDGHPFDIDKMLFMDWRDAHLPEGSEIRERNRRIP                    TFLYAMPFSPTRIFLEETSLVARPGLAMDDIQERMAARLRHLGIRVRAVEEDERCVIP                    MGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLATAPIVADAIVRFLDTGSGDSAFA                    GDALSAEVWRELWPAQRRRQREFFCFGMDILLKLDLDGTRRFFDAFFDLEPRYWHGFL                    SSRLFLPELAMFGLSLFAKASNTSRLEIMAKGTAPLAKMIGNLIQDRDR</aaseq>|
 
DNA = <dnaseqindica>1..804#caggtcgcctatggcatcctcgccgaggtggacggacacccgttcgacatcgacaagatgctgttcatggactggcgcgacgcgcacctccccgaggggtccgagatcagggagcgcaaccgccgcatcccgacgttcctctacgccatgcccttctccccgacgaggatcttcctcgaggagacctccctcgtggcgcgcccgggcctcgccatggacgacatccaggagcgcatggcggcgaggctgcgccacctcgggatacgcgtccgcgccgtggaggaggacgagcggtgcgtcatccccatgggcggcccgctcccggtgctcccgcagcgggtcgtcggcatcggcggcaccgccgggatggtgcacccgtccacgggctacatggtggcgcgcaccctcgccactgcgcccatcgtggcggacgccatcgtgcgcttcctcgacaccggcagcggcgacagcgcgttcgccggcgacgcgctgtcggcggaggtgtggagggagctgtggccggcgcagaggaggaggcagagggagttcttctgcttcggcatggacatcctcctcaagctcgacctcgacggcacgcggcgattcttcgacgccttcttcgacctggagccgcgctactggcacggcttcctgtcgtcgaggctcttcttgccggagctcgccatgttcggcctctccctcttcgccaaggcctccaacacgtcgcgcctcgagatcatggccaagggcaccgcccctctcgccaagatgatcggcaacctcatccaggacagagataggtgaggtgaggatctgcatcatctctcatctcaagatctgcatttggatcactgaattttgctgctgctgctgctgctgctgctgctgaatgtatccaagatttgcaaagatgagaacaccattagcagcagcaagctaggagacaatccatccaggagatgaagtgtgtgagttgagtaacaattgctgctgcaaaacacactcttttttaagcctggtgattacaaaatttgagctgtatagttcatatttgaggtatgatgatgtgcctctcaatgtactgtataaatgtcatgatgtcaaac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052686.2 RefSeq:Os02g0190600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 02:33, 13 December 2016

The rice Os02g0190600 was reported as b-OsLCY in 2008 [1] by researchers from the China.

Annotated Information

Gene Symbol

  • Os02g0190600 <=> b-OsLCY


Function

  • Lycopene b-cyclase (b-OsLCY), which are essential for the biosynthesis of carotenoid precursors of ABA.
  • The impairment of carotenoid biosynthesis causes photo-oxidation and ABA-deficiency phenotypes, of which the latter is a major factor controlling the PHS trait in rice.


Mutant

  • OsLCY RNAi transgenic rice indicated that photo-oxidative damage occurred in PS II, consistent with the accumulation of ROS in these plants.


Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences (CAS), Beijing 100101, China,
  • Graduate University of the CAS, Beijing 100039, China,
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China,
  • Centre for Biological Electron Microscopy, Institute of Biophysics, CAS, Beijing 100101, China,
  • State Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, CAS, Beijing 100093, China,
  • National Centre for Gene Research, CAS, Shanghai 200233, China, and
  • Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, CAS, Beijing 100101,China


References

  1. Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice


Structured Information