Difference between revisions of "Os03g0321700"

From RiceWiki
Jump to: navigation, search
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os08g0189200''' was reported as ''' OsGLP8''' in 2009 <ref name="ref1" /> by researchers from the Japan.  
 +
<br>
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''Os08g0189200 <=> OsGLP8'''
 +
<br>
 
===Function===
 
===Function===
Please input function information here.
+
*'''OsWRKY31''' might be a common component in the signal transduction pathways of the auxin response and the defense response in rice.
 
+
<br>
===Expression===
+
===Mutant===
Please input expression information here.
+
*Analysis of '''OsWRKY31''' and its mutants fused with a Gal4 DNA-binding domain indicated that '''OsWRKY31''' has transactivation activity in yeast. Overexpression of the '''OsWRKY31''' gene was found to enhance resistance against infection with M. grisea, and the transgenic lines exhibited reduced lateral root formation and elongation compared with wild-type and RNAi plants. The lines with overexpression showed constitutive expression of many defense-related genes, such as PBZ1 and OsSci2, as well as early auxin-response genes, such as OsIAA4 and OsCrl1 genes. Furthermore, the plants with
 
+
overexpression were less sensitive to exogenously supplied IBA, NAA and 2,4-D at high concentrations, suggesting that overexpression of the '''OsWRKY31''' gene might alter the auxin response or transport.  
===Evolution===
+
<br>
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Agrobiotechnology, Department of Plant Pathology, China Agricultural University, Yuanmingyuan West Road 2, Beijing 100094, China
 +
<br>
 +
==References==
 +
<references>
 +
<ref name="ref1">
 +
Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants
 +
</ref>
  
==References==
+
</references>
Please input cited references here.
+
<br>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0321700|
 
Description = Similar to WRKY transcription factor 55|
 
Version = NM_001056497.1 GI:115452722 GeneID:4332680|
 
Length = 1254 bp|
 
Definition = Oryza sativa Japonica Group Os03g0321700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:11701554..11702807|
 
CDS = 11701606..11701658,11701777..11701881,11702174..11702648|
 
GCID = <gbrowseImage1>
 
name=NC_008396:11701554..11702807
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:11701554..11702807
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtctcctgtgccgagtccgcatcaatcacaccatctaggccatggctcaaggaaagagaagcgcatgaggaaggtggatacctttgcgccgcacaacgacggccaccagtggaggaagtacggcgagaagaagataaacaactgtaatttccccagatactactacagatgcacctataaagataacatgaattgcccagcaacgaagcagattcagcagaaagattatagtgatccaccattgtactcagtcacctactacaatgagcatacatgtaatagtgcttttcttcctcttagcccctcagagttccagctgcagactgcatctgggaaggcagtctccatctgctttgaatcatctggggctcaagaaccaatgaccaatgccagctcaccttcttcaagcgcagcacggcgtagcacaccttcagagaacaagaatcagcctcttccacggcattcggaagcctattcttggggggttggtgttgtagaacaaaagccgtcctgcactgagctccaatcttgcagcaccgaatgtcaggatgcattttcagctggtacgattcctgaagagacagtagatgcaggaagatttggttctatcagattcttccattttttgtaa</cdnaseq>|
 
AA = <aaseq>MSPVPSPHQSHHLGHGSRKEKRMRKVDTFAPHNDGHQWRKYGEK                    KINNCNFPRYYYRCTYKDNMNCPATKQIQQKDYSDPPLYSVTYYNEHTCNSAFLPLSP                    SEFQLQTASGKAVSICFESSGAQEPMTNASSPSSSAARRSTPSENKNQPLPRHSEAYS                    WGVGVVEQKPSCTELQSCSTECQDAFSAGTIPEETVDAGRFGSIRFFHFL</aaseq>|
 
DNA = <dnaseqindica>53..105#224..328#621..1095#ctagcatttctctctccgggtgtgtctctctctttctttctctctggaaacaatgtctcctgtgccgagtccgcatcaatcacaccatctaggccatggctcaaggtagctaaaaactattactggtcttttggtttttgatctttataagagagtggtgatgatagtgcaggggggattcaattggagtagaagttgatatgtttctgaaaaaaacttgcaggaaagagaagcgcatgaggaaggtggatacctttgcgccgcacaacgacggccaccagtggaggaagtacggcgagaagaagataaacaactgtaatttccccaggttcggatgaaagatgatatatttgcagtatatttcctcatttctggtatctgcatctgtatatcttctggaaagagtgggcatctgttcattcttgtcaaccttgtcctctcctgcaaacaataagaaatttatcagttagacacctttctgtgatgatacttagatgctcttctcattctacccacccaaatcgaccacaaagagatgtgttgcaacaaatagtcgtagaaaactgaacccttttcttgttcatttcactcaaactgttgtctcgcctgtctcattgcagatactactacagatgcacctataaagataacatgaattgcccagcaacgaagcagattcagcagaaagattatagtgatccaccattgtactcagtcacctactacaatgagcatacatgtaatagtgcttttcttcctcttagcccctcagagttccagctgcagactgcatctgggaaggcagtctccatctgctttgaatcatctggggctcaagaaccaatgaccaatgccagctcaccttcttcaagcgcagcacggcgtagcacaccttcagagaacaagaatcagcctcttccacggcattcggaagcctattcttggggggttggtgttgtagaacaaaagccgtcctgcactgagctccaatcttgcagcaccgaatgtcaggatgcattttcagctggtacgattcctgaagagacagtagatgcaggaagatttggttctatcagattcttccattttttgtaaatgaattaatggaagacagtttattttatttcaaagagctaatatgatacacatgttttttcctctacaccctcaaagagtatgagaggttttccttgcatgtcaccatgaatttcttagttgaattgaaataccagtgctaatttacattccagagtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056497.1 RefSeq:Os03g0321700]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 05:09, 14 December 2016

The rice Os08g0189200 was reported as OsGLP8 in 2009 [1] by researchers from the Japan.

Annotated Information

Gene Symbol

  • Os08g0189200 <=> OsGLP8


Function

  • OsWRKY31 might be a common component in the signal transduction pathways of the auxin response and the defense response in rice.


Mutant

  • Analysis of OsWRKY31 and its mutants fused with a Gal4 DNA-binding domain indicated that OsWRKY31 has transactivation activity in yeast. Overexpression of the OsWRKY31 gene was found to enhance resistance against infection with M. grisea, and the transgenic lines exhibited reduced lateral root formation and elongation compared with wild-type and RNAi plants. The lines with overexpression showed constitutive expression of many defense-related genes, such as PBZ1 and OsSci2, as well as early auxin-response genes, such as OsIAA4 and OsCrl1 genes. Furthermore, the plants with

overexpression were less sensitive to exogenously supplied IBA, NAA and 2,4-D at high concentrations, suggesting that overexpression of the OsWRKY31 gene might alter the auxin response or transport.

Labs working on this gene

  • State Key Laboratory of Agrobiotechnology, Department of Plant Pathology, China Agricultural University, Yuanmingyuan West Road 2, Beijing 100094, China


References

  1. Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants


Structured Information