|
|
| (8 intermediate revisions by 4 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os03g0356414''' was reported as ''' OsDIS1''' in 2011 <ref name="ref1" /> by researchers from the China. |
| − | | + | <br> |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''Os03g0356414 <=> OsDIS1''' |
| | + | <br> |
| | ===Function=== | | ===Function=== |
| − | 1. OsDIS1 (for Oryza sativa drought-induced SINA protein 1), a C3HC4 RING finger E3 ligase, is involved in drought-stress signal transduction in rice (O. sativa).
| + | *'''OsDIS1''' plays a negative role in drought stress tolerance through transcriptional regulation of diverse stressrelated genes and possibly through posttranslational regulation of OsNek6 in rice. |
| − | 2. OsDIS1 possessed E3 ubiquitin ligase activity and that the conserved region of the RING finger is required for the activity.
| + | <br> |
| − | 3. Overexpression of OsDIS1 reduce drought tolerance in transgenic rice plants, while RNA interference silencing of OsDIS1 enhance drought tolerance.
| |
| − | 4. A large number of drought-responsive genes were induced or suppressed in the OsDIS1 overexpression plants under normal and drought conditions.
| |
| − | 5. OsDIS1 plays a negative role in drought stress tolerance through transcriptional regulation of diverse stress-related genes and possibly through posttranslational regulation of OsNek6 in rice.
| |
| − | | |
| | ===Expression=== | | ===Expression=== |
| − | OsDIS1, a functional E3 ligase, interacts with an E2 (OsUBCx) and few substrates or partners to negatively regulates drought stress tolerance. Specifically, | + | *The expression of '''OsDIS1''' was up-regulated by drought treatment. In vitro ubiquitination assays showed that '''OsDIS1''' possessed E3 ubiquitin ligase activity and that the conserved region of the RING finger was required for the activity. Transient expression assays in Nicotiana benthamiana leaves and rice protoplasts indicated that '''OsDIS1''' was localized predominantly in the nucleus. |
| − | OsDIS1 interacts with a serine/threonine protein kinase OsNek6 and promotes its degradation via the 26S proteasome dependent pathway. In additional, OsDIS1 interacts with the drought and salt positive regulator OsSKIPa in rice.[[File:osDIS1.jpg]] | + | <br> |
| − | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Among the analyzed 378 RING finger-type and 76 U-box-type E3 ubiquitin ligase genes in rice, a drought induced C3HC4 RING finger gene (LOC_Os03g24040) was identified.The deduced protein of this gene contains conserved RING finger and zinc finger motifs and has high sequence
| + | *Overexpression of '''OsDIS1''' reduced drought tolerance in transgenic rice plants, while RNA interference silencing of '''OsDIS1''' enhanced drought tolerance. |
| − | identity (82%) with SINAT5 in Arabidopsis,which 2002), which was identified as a homolog of ''Drosophila'' SINA.A genome-wide search identified five paralogous SINA proteins of OsDIS1 in the rice genome. The amino acid identity between OsDIS1 and its paralogs is 91% with Os07g46560, 83% with Os02g19140, 83% with Os05g14860, 83% with Os01g13370, and 71% with Os02g03620. Further alignment between rice and Arabidopsis SINA proteins revealed that except for the N terminus, all the SINA members in rice and Arabidopsis had highly conserved sequences, and all contained the conserved RING finger and zinc finger motifs.Phylogenetic analysis showed that each of the following protein pairs belongs to the same clade: SINAT1 and SINAT2, SINAT4 and SINAT5, and OsDIS1 and Os07g46560; this supports the inference of a possible duplication of these genes in both genomes. Based on pairwise distance analysis, OsDIS1 has a minimal distance of 0.0725 with Os0746560 in rice and 0.2624 with SINAT5 in Arabidopsis,suggesting that Os07g46560 is the closest paralog of OsDIS1 in rice and SINAT5 is the closest ortholog of OsDIS1 in Arabidopsis.
| + | <br> |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | State Laboratory for Biology of Plant Diseases and Insect Pests; Institute of Plant Protection; Chinese Academy of Agricultural Sciences; Beijing, China State Key Laboratory of Plant Genomics; National Center for Plant Gene Research; Institute of Genetics and Developmental Biology; Chinese Academy of Sciences; Beijing, China Hunan Provincial Key Laboratory of Crop Germplasm Innovation and Utilization; Hunan Agricultural University; Changsha Hunan, China; Department of Plant Pathology;Ohio State University; Columbus, OH USA;Department of Applied Plant Sciences Technology, Kangwon National University;Department of Systems Biology, College of Life Science and Biotechnology, Yonsei University,Seoul 120–749,Korea.
| + | *Hunan Provincial Key Laboratory of Crop Germplasm Innovation and Utilization, Hunan Agricultural University, Changsha Hunan 410128, China (Y.N., J.L., X.W., X.L., L.D., G.-L.W.); |
| − | | + | *State Key Laboratory of Plant Genomics, National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China (Y.N., Q.Z., H.Z., L.L., S.T., Q.X.); |
| − | | + | *State Laboratory for Biology of Plant Diseases and Insect Pests, Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Beijing 100193, China (Y.N., G.-L.W.); |
| | + | *Department of Plant Pathology, Ohio State University, Columbus, Ohio 43210 (Y.N., C.J., S.C., C.H.P., G.-L.W.) |
| | + | <br> |
| | ==References== | | ==References== |
| − | 1. Ning,Yuese and Jantasuriyarat.The SINA E3 ligase OsDIS1 negatively regulates drought response in rice.Plant physiology.2011,157:242--255;
| + | <references> |
| − | 2. Ning, Yuese and Xie.OsDIS1-mediated stress response pathway in rice.Plant Signal Behav.2011,6:1684--1686;
| + | <ref name="ref1"> |
| − | 3. Yamada, Yasuyuki and Koyama.Basic helix-loop-helix transcription factors and regulation of alkaloid biosynthesis.Plant Signal Behav.2011,6:1627--1630;
| + | The SINA E3 Ligase OsDIS1 Negatively Regulates Drought Response in Rice |
| − | 4. Deikman, Jill and Petracek.Drought tolerance through biotechnology: improving translation from the laboratory to farmers’ fields.Current opinion in biotechnology.2012,23:243--250;
| + | </ref> |
| − | 5. Lim, Sung Don and Hwang.Comprehensive Analysis of the Rice RING E3 Ligase Family Reveals Their Functional Diversity in Response to Abiotic stress.DNA research.2013,20:299--314;
| |
| − | 6. Cho, Seok Keun and Ryu.The Arabidopsis RING E3 ubiquitin ligase AtAIRP2 plays combinatory roles with AtAIRP1 in abscisic acid-mediated drought stress responses.Plant physiology.2011,157:2240--2257
| |
| | | | |
| | + | </references> |
| | + | <br> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 03]] |
| − | GeneName = Os03g0356414|
| |
| − | Description = Similar to Ubiquitin ligase SINAT5 (EC 6.3.2.-) (Seven in absentia homolog 5). Splice isoform 2|
| |
| − | Version = NM_001186491.1 GI:297722112 GeneID:9266295|
| |
| − | Length = 3760 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0356414, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:14184730..14188489|
| |
| − | CDS = 14185089..14185409,14185874..14186260,14186613..14186810|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:14184730..14188489
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:14184730..14188489
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcctcagttacttatattgatgactccggttctgaggtaattgatcctccaaagactgaggtgctggatgttaccgaacttgctggtgatcctgttccgcattcaccaaaaccaaatgtggtagtttctagcagtgtgcgtgaactgcttgaatgtccagtctgcctgagcgcaatgtatcctcccattcatcagtgctctaatggtcatacattgtgctctggatgcaaaccaagggttcacaatcgctgtccaacttgtaggcatgaactgggtaatattagatgtcttgctctcgagaaggtggctgcgtcgcttgaacttccatgcaagtaccagaacttcgggtgtgtaggcatttatccttactactgcaagctgaagcatgagtcacagtgccaatataggccttatagctgtccatatgctggatctgaatgcacagttgctggtgacattccatacttggtgaatcacttgaaagatgaccacaaggttgacatgcataatggctgcaccttcaaccatcgctatgtcaagtcgaatcctcatgaagttgagaatgccacctggatgcttacggttttcagctgctttggccagtacttctgcctacatttcgaagcatttcagctggggatggcacctgtgtacatcgccttcctgaggttcatgggtgatgacttggaagcaaagaactacagctacagcctggaggtaggaggcactggccgcaaaatgatctggcaaggggttccccggagcatcagagacagccatcggaaggtccgggatagctatgatgggcttatcatccaacggaacatggccttgttcttctctggtggagaaaggaaggagctcaaattgcgggtcactgggagaatttggaaggaacagtga</cdnaseq>|
| |
| − | AA = <aaseq>MASVTYIDDSGSEVIDPPKTEVLDVTELAGDPVPHSPKPNVVVS SSVRELLECPVCLSAMYPPIHQCSNGHTLCSGCKPRVHNRCPTCRHELGNIRCLALEK VAASLELPCKYQNFGCVGIYPYYCKLKHESQCQYRPYSCPYAGSECTVAGDIPYLVNH LKDDHKVDMHNGCTFNHRYVKSNPHEVENATWMLTVFSCFGQYFCLHFEAFQLGMAPV YIAFLRFMGDDLEAKNYSYSLEVGGTGRKMIWQGVPRSIRDSHRKVRDSYDGLIIQRN MALFFSGGERKELKLRVTGRIWKEQ</aaseq>|
| |
| − | DNA = <dnaseqindica>3081..3401#2230..2616#1680..1877#aaaaaacgcgagaagagagagagagaagcttttaattcgaattctctctctcatcacggcttcttctgcttctccttctcctcccccctcatccctcctccgccggtagccgccggccgggagcgagcagcgagcgagaccggagcccgccggagccggtctcgctcccccctcctcccttgttcgcgccacccccgaggtacatcccgccgatctctctctttctctctctcgttggtctgctctgtgattttttttttttttgccaaggctgttctttatttggcacagagattgttttttttttccttctttgcgggtgtccggttcgagtccacggggtttgactctgccggaaatggttcgaatgcggcggccggagggcggaggaggggttttggggggcgttcttggtgggttggtttgcgccgagtctttgttaatttgttagggttcttgatctgatgcggcttctcgttgccgggatgcgcttgcctcatggctgaattcaaacaggccggtctctctctccctccctctctcccgtcagccgtgtgctttgaccgagtaagtttttgaacttcgattggttgagctgggggttcttgactttttcttactccacgaatgttcctttttgcacaatggggctactaatgaatggaaagctagagatggtgtgcctaatggtgatgtgccgtcattgtgttagctcggatttgtactgcgaatttgcgagctcacatgctcagctgatgatgtgttgatccagggagtatatataattggttggtagagtacttgctagattgtgctcacgggtctcatttcaaagttcagtatgaaatcttggttgtaaagtagtactagtgttttgttaatcgttagggagtacttctcctgcatttttcttaattttttccctttaaaaactgtaggtggatttgttattagtaaagctgatttgtgccaaatagaaattctgttttatccgcagtaaggtactgtaaacagtacttgcaggcactagggtttattggcaaggttttctatgttacattttaataaatgccacctttttcttcgtcaaaagaagccacggttataaagaaaaagtgaagcattaattgatgtaaatgcacgaactacaaatttccacaaatataaaccttttaataaaatccacaaatgaaagaaaaatgcagttcacacaccaatctctttctcaaaatttacacttttcttataacaggtatgctaaattttcttaatacaaagcatatacaaaacatcacaagcactatagacattcatgacatatctgttgcataggacaatatgcagtatgaagacctggctggtcaaaacttccgatgcacatgtgaggccctatccatgtgctttcttgatttctgctcctttatggccctatctccttcaaagcccttaaacacttcaacagtgtccaatcatactatgagactgtatggatatgggcatatggctatacttttgatgaggcaatgattttttttgttaataatagtgttaataggaagtgttgaattggttttttaaaaggaagtatttaagcattgaatttgtcatttattttgactcactaataacacagatagttctctttcctagcaggaccccttacaatatctagtgtatttatggcctcagttacttatattgatgactccggttctgaggtaattgatcctccaaagactgaggtgctggatgttaccgaacttgctggtgatcctgttccgcattcaccaaaaccaaatgtggtagtttctagcagtgtgcgtgaactgcttgaatgtccagtctgcctgagcgcaatgtatcctcccattcatcaggtgcacatataccacttattgaatcttttttgcacttaaaaaggatattttcttgtatggaagtcacttgggaaacaaaatgcgtgtttcatttaattgcattgcttttactatcttgaatcctgctatcatatttgtagtctggcctgatctatttgaacttatctagatgatttcctggtttaaaacggtcgttctgagctgctttttcacatatgttctgttccactaccaaattgttacccatgtatttaagcaccaaaaaagaagttagctaagatagtatgtacaatatgcacattgttgtactatgttgtaagttgtaaccccaactctttttctgctaatgcagtgctctaatggtcatacattgtgctctggatgcaaaccaagggttcacaatcgctgtccaacttgtaggcatgaactgggtaatattagatgtcttgctctcgagaaggtggctgcgtcgcttgaacttccatgcaagtaccagaacttcgggtgtgtaggcatttatccttactactgcaagctgaagcatgagtcacagtgccaatataggccttatagctgtccatatgctggatctgaatgcacagttgctggtgacattccatacttggtgaatcacttgaaagatgaccacaaggttgacatgcataatggctgcaccttcaaccatcgctatgtcaagtcgaatcctcatgaagttgagaatgccacctggatgcttacggtatcccctcgttaactccaccatgttagttattgtgaagtatatcactgatgtttacttatgcaaagattggttcacttgtctgctaagatagtccatatttctgtactgagttttatgagcctttctgtaaaaataaacattggttcacttgtacagtatgattgcactctgtacttttcatgtcaactgaggatgctgatcatgcagcatagttattggtctaaaataatctctcacctatgaagaaactatgcatcagaatatccatctgcttccatttccaaaaaaaaaaaaaaaaactttgtctgctttacagcacaataatagcatttggacagggctcttgatctgcaaccttttcttgctgctttctaagtgcaatataaaattaagaatttccttctaatctgttcttttccattgaacaaaatggactaagtaactataatgcttccatctaggttttcagctgctttggccagtacttctgcctacatttcgaagcatttcagctggggatggcacctgtgtacatcgccttcctgaggttcatgggtgatgacttggaagcaaagaactacagctacagcctggaggtaggaggcactggccgcaaaatgatctggcaaggggttccccggagcatcagagacagccatcggaaggtccgggatagctatgatgggcttatcatccaacggaacatggccttgttcttctctggtggagaaaggaaggagctcaaattgcgggtcactgggagaatttggaaggaacagtgaaaataaaatgtgaaatgatctgttcatcgttcttaacccttgcatgaacctatgtatcatcacagtgcgagaattatagccattcataggcagtgactctaaaatgaagacttgtaatgttattagcttgttttagctaccatcttctgttagattggtgcctgtggatgactagatgacagtcatgtagaccagagtggcactattgtagaattcctggcaaacttctctttgccttgaactgcttgttgagttgccattctgtggtatagggaaatctaatggcaattcatgagatgaatgtgttgaactctttttcatgtttccagcatatttctagcttctttgttcattctttc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186491.1 RefSeq:Os03g0356414]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 3]] | |
| − | [[Category:Chromosome 3]]
| |