Difference between revisions of "Os01g0197700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
 
(10 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Gn1a, is a gene for cytokinin oxidase/dehydrogenase (OsCKX2). Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.
+
The rice gene Os01g0197700 was reported as '''''Gn1a''''' in 2005<ref name="ref1" /> by researchers from China and Japan.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os01g0197700 <=> Gn1a, OsCKX2, CKX2, ckx2, Gn1a/OsCKX2, Os CKX2, CKX2/Gn1a
 +
 
===Function===
 
===Function===
[[File:Eeee.jpg|right|thumb|350px| ''
+
* '''''Gn1a''''' is a quantitative trait loci (QTLs) that increases grain productivity in rice.
QTL analysis and molecular cloning. (A) Gross morphology of Koshihikari and Habataki at maturity.(D) Comparison of grain number in the main panicle of Koshihikari (Ko), Habataki (Ha), and 5150. (H) High-resolution linkage map of Gn1a. (I) OsCKX2 structure and mutation sites in Habataki (blue) and 5150 (red). (K) Comparison of grain number per main panicle in nontransgenic and transgenic lines. 2 copy CKX2, transgenic <ref name="ref1" />).'']]
+
* '''''Gn1a''''', is a gene for cytokinin oxidase/ dehydrogenase (OsCKX2), an enzyme that degrades the phytohormone cytokinin.
Expression level of OsCKX2 can influence the amount of phytohormone cytokinin,Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.Transgenic plants carrying two copies of the sense strand of OsCKX2 that was highly expressed showed reduced grain numbers compared to TC65. However, transgenic plants with antisense strands of OsCKX2 that had reduced levels of expression developed higher grain numbers.
+
===Mutation===
OsCKX2 reduce CKX activity in Habataki, NIL-Gn1a, and 5150, and the increased production of CK conjugates to reduce the overall CK activity .
+
* Reduced expression of '''''OsCKX2''''' causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.
 
+
===Expression ===
===Protein Structure===
 
[[File:搜狗截图14年05月23日1804 1.png|left|thumb|550px| ''Conserved domains on OsCKX2.'']]
 
 
 
The OsCKX2 of Koshihikari and Habataki consist of four exons and three introns and encode proteins of 565 or 563 amino acids, respectively. the region between 74 – 255 is FAD-binding PCMH-type domian. it has UDP-N-acetylmuramate dehydrogenase activity, cytokinin dehydrogenase activity and flavin adenine dinucleotide binding.<ref name="ref2" />
 
 
 
 
 
===Expression===
 
[[File:Dfghjj.png|left|thumb|150px| ''Expression profile of OsCKX2.'']]
 
transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems<ref name="ref1" />.
 
The expression of OsCKX2 will directly influence the amount of cytokinin oxidase/dehydrogenase which degrades the phytohormone cytokinin, so the expression level of OsCKX2 will directly affect the Rice Grain Production by causeing cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs.The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem (35). The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems.
 
[[File:F3.medium.jpg|right|thumb|150px|Phenotypic characterization of NIL-QTLs(from reference  <ref name="ref3" />).'']]
 
  
 
===Evolution===
 
===Evolution===
[[File:Fggg.png|right|thumb|250px| ''Phylogenetic relationship of CKX proteins in rice and Arabidopsis.'']]
+
[[File:Os01g0197700-1.png|center|thumb|300px|'''Phylogenetic relationship of CKX proteins in rice and Arabidopsis.''' '' <ref name="ref1" />.'']]
Phylogenetic relationship of CKX proteins in rice and Arabidopsis.<ref name="ref1" />
+
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan.
*Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan
+
* Plant Science Center, RIKEN, Tsurumi, Yokohama 230-0045, Japan.
*Plant Science Center, RIKEN, Yokohama 230-0045, Japan
+
* Honda Research Institute Japan Co., Ltd., Kisarazu, Chiba, 292- 0818 Japan.
 
+
* China National Rice Research Institute, Hangzhou, 310006, China.
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="ref1">
+
* <ref name="ref1">
Ashikari, M., Sakakibara, H., Lin, S., Yamamoto, T., Takashi, T., Nishimura, A., ... & Matsuoka, M. (2005). Cytokinin oxidase regulates rice grain production. Science, 309(5735), 741-745.</ref>
+
Ashikari M, Sakakibara H, Lin S, et al. Cytokinin oxidase regulates rice grain production[J]. Science, 2005, 309(5735): 741-745.
<ref name="ref2">
+
</ref>
http://www.uniprot.org/uniprot/Q4ADV8</ref>
 
 
</references>
 
</references>
 
  
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 01]]
GeneName = Os01g0197700|
 
Description = OsCKX2,cytokinin oxidase/dehydrogenase|
 
Version =AB205193.1  GI:71609872.(gene version=Gene ID: 4327334)|
 
Length = 1698 bp|
 
Definition = Oryza sativa Japonica Group OsCKX2 mRNA for cytokinin oxidase/dehydrogenase, complete cds.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:5273310..5274501|
 
CDS = 1..625,717..1192|
 
GCID = <gbrowseImage1>
 
name=NC_008394:5273310..5274501
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:5273310..5274501
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaagcaagagcaggtcaggatggcagtgctcctcatgctcaactgcttcgtcaaggccacggcgccgccgccatggccgccgtcggcttcgtccgcctccttcctcgacgacctcggcgacctcggcatcgcgccgctcatccgcgccgacgaggcgggcaccgcgcgcgcctccgccgactttggcaacctctccgtcgccggcgtcggggcgcctcggctcgccgccgccgccgccgtgctctacccgtcgcgccccgccgacatcgccgcgctgctgcgcgcgtcgtgcgcacgcccggcgccgttcgcggtgtccgcgcgggggtgtggccactcggtgcacggccaggcctccgcgcccgacggcgtcgtcgtcgacatggcgtcgctcggccgcctgcagggcggcggcgcgcggcgcctcgccgtgtcagtggaggggcggtacgtcgacgccggcggcgagcagctgtgggtggacgtgctgcgcgcgtccatggcgcacgggctcacgccggtgtcgtggacagactacctccacctcaccgtcggcggcacgctgtccaacgccggcatcagcggccaggccttccgccatggcccccagatttccaacgtgctagagctcgacgtcatcaccggtgtcggggagatggtgacgtgctcgaaggagaaggcgccggacctgttcgacgcggtgctgggcgggctggggcagttcggcgtcatcacgcgggcgcgcatcccgctcgcgccggcgccggcgagggcgcggtgggtgcggttcgtgtacacgacggcggcggcgatgacggccgaccaggagcgcctcatcgccgtcgatcgcgccggcggcgccggcgcggtgggcgggctgatggactacgtcgagggctcggtccacctgaaccagggcctggtcgagacctggcgcacgcagccgcagccgccttcgccgtcctcctcctcctcctcatccttcttctccgacgccgacgaggcccgcgtcgccgcgctcgccaaggaggccggcggcgtgctgtatttcctcgagggcgccatctacttcggcggcgccgccgggccgtccgccgccgacgttgacaagaggatggatgtgctgcgtcgcgagctgcggcacgagcgcgggttcgtgttcgcgcaggacgtggcgtacgccgggttcctggaccgcgtccacgacggcgagctcaagctccgcgccgcggggctctgggacgtgccgcacccatggctgaacctgttcctcccccgctccggcgtcctcgccttcgccgacggcgtcttccacggcatcctcagccgcacccccgccatgggccccgtcctcatctaccccatgaaccgcaacaagtgggacagtaacatgtcggcagtgatcaccgacgacgacggtgacgaggtgttctacacggtggggatcctgcggtcggcggcggcggccggcgacgtggggaggctggaggagcagaacgacgagatcttgggtttctgcgaggtggccgggatagcctacaagcagtacctgccttactacggcagccaggcagagtggcagaagcggcacttcggtgccaatctctggccaagattcgtgcagcggaagagcaagtatgatccaaaggccatcctgtcccgtggccaggggattttcacgtcaccactcgcatga</cdnaseq>|
 
AA = <aaseq>MKQEQVRMAVLLMLNCFVKATAPPPWPPSASSASFLDDLGDLGI
 
                    APLIRADEAGTARASADFGNLSVAGVGAPRLAAAAAVLYPSRPADIAALLRASCARPA
 
                    PFAVSARGCGHSVHGQASAPDGVVVDMASLGRLQGGGARRLAVSVEGRYVDAGGEQLW
 
                    VDVLRASMAHGLTPVSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVLELDVITGVG
 
                    EMVTCSKEKAPDLFDAVLGGLGQFGVITRARIPLAPAPARARWVRFVYTTAAAMTADQ
 
                    ERLIAVDRAGGAGAVGGLMDYVEGSVHLNQGLVETWRTQPQPPSPSSSSSSSFFSDAD
 
                    EARVAALAKEAGGVLYFLEGAIYFGGAAGPSAADVDKRMDVLRRELRHERGFVFAQDV
 
                    AYAGFLDRVHDGELKLRAAGLWDVPHPWLNLFLPRSGVLAFADGVFHGILSRTPAMGP
 
                    VLIYPMNRNKWDSNMSAVITDDDGDEVFYTVGILRSAAAAGDVGRLEEQNDEILGFCE
 
                    VAGIAYKQYLPYYGSQAEWQKRHFGANLWPRFVQRKSKYDPKAILSRGQGIFTSPLA</aaseq>|
 
DNA = <dnaseqindica>1..625#717..1192#ATGGCAGTGCTCCTCATGCTCAACTGCTTCGTCAAGGCCACGGCGCCGCCGCCATGGCCGCCGTCGGCTT
 
CGTCCGCCTCCTTCCTCGACGACCTCGGCGACCTCGGCATCGCGCCGCTCATCCGCGCCGACGAGGCGGG
 
CACCGCGCGCGCCTCCGCCGACTTTGGCAACCTCTCCGTCGCCGGCGTCGGGGCGCCTCGGCTCGCCGCC
 
GCCGCCGCCGTGCTCTACCCGTCGCGCCCCGCCGACATCGCCGCGCTGCTGCGCGCGTCGTGCGCACGCC
 
CGGCGCCGTTCGCGGTGTCCGCGCGGGGGTGTGGCCACTCGGTGCACGGCCAGGCCTCCGCGCCCGACGG
 
CGTCGTCGTCGACATGGCGTCGCTCGGCCGCCTGCAGGGCGGCGGCGCGCGGCGCCTCGCCGTGTCAGTG
 
GAGGGGCGGTACGTCGACGCCGGCGGCGAGCAGCTGTGGGTGGACGTGCTGCGCGCGTCCATGGCGCACG
 
GGCTCACGCCGGTGTCGTGGACAGACTACCTCCACCTCACCGTCGGCGGCACGCTGTCCAACGCCGGCAT
 
CAGCGGCCAGGCCTTCCGCCATGGCCCCCAGATTTCCAACGTGCTAGAGCTCGACGTCATCACCGGTACG
 
TAGATCCATCACATCTACTAAGACACGCGCCGCCATGATCGAGGTAATTAAGGTATAGGTGTTTTGACGT
 
ATACATGTATCTGCAGGTGTCGGGGAGATGGTGACGTGCTCGAAGGAGAAGGCGCCGGACCTGTTCGACG
 
CGGTGCTGGGCGGGCTGGGGCAGTTCGGCGTCATCACGCGGGCGCGCATCCCGCTCGCGCCGGCGCCGGC
 
GAGGGCGCGGTGGGTGCGGTTCGTGTACACGACGGCGGCGGCGATGACGGCCGACCAGGAGCGCCTCATC
 
GCCGTCGATCGCGCCGGCGGCGCCGGCGCGGTGGGCGGGCTGATGGACTACGTCGAGGGCTCGGTCCACC
 
TGAACCAGGGCCTGGTCGAGACCTGGCGCACGCAGCCGCAGCCGCCTTCGCCGTCCTCCTCCTCCTCCTC
 
ATCCTTCTTCTCCGACGCCGACGAGGCCCGCGTCGCCGCGCTCGCCAAGGAGGCCGGCGGCGTGCTGTAT
 
TTCCTCGAGGGCGCCATCTACTTCGGCGGCGCCGCCGGGCCGTCCGCCGCCGACGTTGACAAGGTATACT
 
AG
 
</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NC_008394.3?report=fasta&from=5273310&to=5274501&strand=true]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 10:54, 20 December 2016

The rice gene Os01g0197700 was reported as Gn1a in 2005[1] by researchers from China and Japan.

Annotated Information

Gene Symbol

  • Os01g0197700 <=> Gn1a, OsCKX2, CKX2, ckx2, Gn1a/OsCKX2, Os CKX2, CKX2/Gn1a

Function

  • Gn1a is a quantitative trait loci (QTLs) that increases grain productivity in rice.
  • Gn1a, is a gene for cytokinin oxidase/ dehydrogenase (OsCKX2), an enzyme that degrades the phytohormone cytokinin.

Mutation

  • Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.

Expression

Evolution

Phylogenetic relationship of CKX proteins in rice and Arabidopsis. [1].

You can also add sub-section(s) at will.

Labs working on this gene

  • Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan.
  • Plant Science Center, RIKEN, Tsurumi, Yokohama 230-0045, Japan.
  • Honda Research Institute Japan Co., Ltd., Kisarazu, Chiba, 292- 0818 Japan.
  • China National Rice Research Institute, Hangzhou, 310006, China.

References

  1. 1.0 1.1 Ashikari M, Sakakibara H, Lin S, et al. Cytokinin oxidase regulates rice grain production[J]. Science, 2005, 309(5735): 741-745.


Structured Information