Difference between revisions of "Os04g0475900"

From RiceWiki
Jump to: navigation, search
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os04g0475900 was reported as '''''Rf17''''' in 2009<ref name="ref1" /> by researchers from Japan.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os04g0475900 <=> RFcw, RFCW, Rfcw, Rf17
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The researchers identified a nuclear candidate gene, '''''RETROGRADE-REGULATED MALE STERILITY (RMS)''''' for '''''Rf17''''', a fertility restorer gene for Chinese wild rice (CW)-type CMS in rice (Oryza sativa L.).
 
+
* '''''RMS''''' encodes a mitochondrial protein, 178 aa in length, of unknown function, unlike the majority of other Rf genes cloned thus far, which encode pentatricopeptide repeat proteins.
===Expression===
+
===Mutation===
Please input expression information here.
+
* RNA interference-mediated gene silencing of RMS restored fertility to a CMS plant, whereas its overexpression in the fertility restorer line induced pollen abortion.
 +
===Expression ===
 +
* The mRNA expression level of '''''RMS''''' in mature anthers depended on cytoplasmic genotype, suggesting that RMS is a candidate gene to be regulated via retrograde signaling.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Laboratory of Environmental Biotechnology, Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutumidori Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan
 
 
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Fujii S, Toriyama K. Suppressed expression of RETROGRADE-REGULATED MALE STERILITY restores pollen fertility in cytoplasmic male sterile rice plants[J]. Proceedings of the National Academy of Sciences, 2009, 106(23): 9513-9518.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]]
GeneName = Os04g0475900|
 
Description = Conserved hypothetical protein|
 
Version = NM_001059611.1 GI:115458951 GeneID:4336151|
 
Length = 853 bp|
 
Definition = Oryza sativa Japonica Group Os04g0475900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:24217103..24217955|
 
CDS = 24217319..24217855|
 
GCID = <gbrowseImage1>
 
name=NC_008397:24217103..24217955
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:24217103..24217955
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgatggcggcggcggagctcggggtggggatggcaaaggcggcggctctccacaacgacgacttggcgaggcgacgacgacggcgaggaagatgcagccacgacagcacatgggcagggatggcactggaggcacatggcggccacggcgacggagtcgagggagaggcgcgggaagccgcaaggggtggccctctgctcctcgccggccttgcctggtcctccgccgccttgtcgccgtggctccgctggttccgggaggcaggggcgagagagaggagggagggagtgaggtggagcgcggggactcggttccaggcgatggtggaagggggacggcaggggaggcagggcaaaagaggcgctcgcgcctccggtccatttcggcggagggcggcgatggaagcagccgaggcagcgttgaagagtttggggacagagagaatgcgagatgtgggaagaaaaatatggttgtgggtcccacaatcccacagttggagagccagttttggctggccaagtttagccacctag</cdnaseq>|
 
AA = <aaseq>MAMAAAELGVGMAKAAALHNDDLARRRRRRGRCSHDSTWAGMAL                    EAHGGHGDGVEGEAREAARGGPLLLAGLAWSSAALSPWLRWFREAGARERREGVRWSA                    GTRFQAMVEGGRQGRQGKRGARASGPFRRRAAMEAAEAALKSLGTERMRDVGRKIWLW                    VPQSHSWRASFGWPSLAT</aaseq>|
 
DNA = <dnaseqindica>217..753#tttctctctctccccccaccttccttctctttccttctttttccccttttccttccttcccgtcgaccacgttgatgccgacggtggctgacacatgacgcgcggtggtgcagcaacgcggggaggcggaaggcggtgcggggaggcggcgctcgctgaggtgctctccctctccctttgcggcgacgaggcgacggcggcggagctcggagcgggatggcgatggcggcggcggagctcggggtggggatggcaaaggcggcggctctccacaacgacgacttggcgaggcgacgacgacggcgaggaagatgcagccacgacagcacatgggcagggatggcactggaggcacatggcggccacggcgacggagtcgagggagaggcgcgggaagccgcaaggggtggccctctgctcctcgccggccttgcctggtcctccgccgccttgtcgccgtggctccgctggttccgggaggcaggggcgagagagaggagggagggagtgaggtggagcgcggggactcggttccaggcgatggtggaagggggacggcaggggaggcagggcaaaagaggcgctcgcgcctccggtccatttcggcggagggcggcgatggaagcagccgaggcagcgttgaagagtttggggacagagagaatgcgagatgtgggaagaaaaatatggttgtgggtcccacaatcccacagttggagagccagttttggctggccaagtttagccacctagggagcccctttggccaaccaaatagcttcgagagtaggatagccagtatgttggagctcgttttttttttcaaaatttctaaattttagtttggggagtg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059611.1 RefSeq:Os04g0475900]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 4]]
 
[[Category:Chromosome 4]]
 

Latest revision as of 15:47, 20 December 2016

The rice gene Os04g0475900 was reported as Rf17 in 2009[1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os04g0475900 <=> RFcw, RFCW, Rfcw, Rf17

Function

  • The researchers identified a nuclear candidate gene, RETROGRADE-REGULATED MALE STERILITY (RMS) for Rf17, a fertility restorer gene for Chinese wild rice (CW)-type CMS in rice (Oryza sativa L.).
  • RMS encodes a mitochondrial protein, 178 aa in length, of unknown function, unlike the majority of other Rf genes cloned thus far, which encode pentatricopeptide repeat proteins.

Mutation

  • RNA interference-mediated gene silencing of RMS restored fertility to a CMS plant, whereas its overexpression in the fertility restorer line induced pollen abortion.

Expression

  • The mRNA expression level of RMS in mature anthers depended on cytoplasmic genotype, suggesting that RMS is a candidate gene to be regulated via retrograde signaling.

Evolution

You can also add sub-section(s) at will.

Labs working on this gene

  • Laboratory of Environmental Biotechnology, Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutumidori Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan

References

  1. Fujii S, Toriyama K. Suppressed expression of RETROGRADE-REGULATED MALE STERILITY restores pollen fertility in cytoplasmic male sterile rice plants[J]. Proceedings of the National Academy of Sciences, 2009, 106(23): 9513-9518.

Structured Information