Difference between revisions of "Os07g0211500"

From RiceWiki
Jump to: navigation, search
 
(9 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Rc is a domestication-related gene required for red pericarp in rice (Oryza sativa) and it encodes a basic helix-loop-helix (bHLH) protein that was fine-mapped to an 18.5-kb region on rice chromosome 7 using a cross between Oryza rufipogon (red pericarp) and O. sativa cv Jefferson (white pericarp).
+
The rice gene Os07g0211500 was reported as '''''Rc''''' in 2006<ref name="ref1" /> by researchers from USA.
===characteristic===
 
 
 
===Mutation===
 
[[File:Clip image002.gif|right|thumb|150px|''picture1. Length mutation (from reference <ref name="ref1" />).'']]
 
[[File:Clip_image0021.gif]]
 
Grain color has been the target of selection in domesticated Asian rice (as well as other domesticated grains), and the vast majority of O. sativa varieties have white (nonpigmented) grains, compared to the dark red grains that characterize the wild relative and other wild species. The genetic basis of white grains in O. sativa has been pinpointed to loss-of-function mutations in the Rc gene, a regulatory protein in the proanthocyanidin synthesis pathway; these loss-of-function mutations prevent the development of a pigmented pericarp layer. A survey of 337 white pericarp rice cultivars showed that the majority (>97%) have a 14-bp deletion in exon 7 of the gene, resulting in a premature stop codon and a non-functional allele referred to as rc.
 
 
 
Our findings for the pericarp color gene, Rc, indicate that remarkably similar genetic mechanisms can be at play. We find that two of the three white pericarp O. glaberrima varieties in our sample harbor a unique point mutation that is predicted to result in a premature stop codon in exon 7 of the Rc gene.
 
 
 
Instead, two samples contained a novel point mutation predicted to result in a premature stop-codon in exon 7, hereafter referred to as allele rc-g1 (Fig. 1). This mutation is 146 bp upstream of the Rc-s point mutation and 201 bp upstream of the initiation of the 14-bp rc deletion. The third white pericarp O. glaberrima contained no identifiable insertions, deletions, or premature stop-codons, nor does it differ from the red-pericarp O. glaberrima sequences for any predicted amino-acid changes. Comparison of this sample to the most closely related red-pericarp sample showed that they were identical for the sequenced region upstream of the start codon (>1.5 kb) and for the first intron; both of these regions are potentially important as cis-regulatory regions in plants.
 
 
 
This study also shows that white pericarps might be achieved by mutations in cis-regulatory regions of Rc or potentially mutations in other genes, a pattern that was not observed in an extensive survey of O. sativa cultivars.
 
  
 +
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os07g0211500 <=> Rc, OsbHLH017, OsbHLH17, SD7-1, qSD7-1/qPC7, OsGL3C, GL3C
  
 
===Function===
 
===Function===
[[File:Struture1.jpg]]
+
[[File:Os07g0211500-1.png|right|thumb|400px|'''Rc allele phenotypes.''' '' <ref name="ref1" />.'']]
 +
* '''''Rc''''' is a domestication-related gene required for red pericarp in rice (Oryza sativa).
  
===Expression===
+
* '''''Rc''''' encodes a basic helix-loop-helix (bHLH) protein that was fine-mapped to an 18.5-kb region on rice chromosome 7 using a cross between Oryza rufipogon (red pericarp) and O. sativa cv Jefferson (white pericarp).
RT-PCR experiments confirmed that the Rc gene was expressed in both red- and white-grained rice but that a shortened transcript was present in white varieties.
 
  
===Nucleotide Polymorphisms===
+
* '''''Rc''''' is a positive regulator of proanthocyanidin.
Phylogenetic analysis, supported by comparative mapping in rice and maize (Zea mays), showed that Rc, a positive regulator of proanthocyanidin, is orthologous with INTENSIFIER1, a negative regulator of anthocyanin production in maize, and is not in the same clade as rice bHLH anthocyanin regulators.[[File:mapping of Rc.jpg]]
 
===Allele Distribution===
 
Sequencing of the alleles from both mapping parents as well as from two independent genetic stocks of Rc revealed that the dominant red allele differed from the recessive white allele by a 14-bp deletion within exon 6 that knocked out the bHLH domain of the protein.
 
  
===Haplotype Diversity===
 
  
 
+
===Expression ===
===Recombination===
+
* '''''Rc''''' gene was expressed in both red- and white-grained rice but that a shortened transcript was present in white varieties.
  
 
===Evolution===
 
===Evolution===
Repeated phenotypic evolution can occur at the interspecific level, where it is manifest as the appearance of the same trait in multiple domesticated species, and at the intraspecific level, where the same trait arises multiple times within a single crop.
+
[[File:Os07g0211500-2.png|center|thumb|400px|'''Figure 5. Phylogenetic Analysis of Rc and Other bHLH Proteins.''' '' <ref name="ref1" />.'']]
In rice, the opportunity exists to examine the genetic basis of repeated trait evolution at both the interspecific and intraspecific level.
+
You can also add sub-section(s) at will.
 
 
At the intraspecific level, repeated phenotypic evolution during domestication can be explored in two contexts; one is the repeated evolution of a trait in varieties resulting from a single domestication event, the other is repeated evolution of a trait in varieties that result from multiple, independent domestication events within the same species.
 
 
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
*Department of Biology, Washington University in St. Louis, St. Louis, Missouri, USA
+
* Department of Plant Breeding and Genetics, Cornell University, Ithaca, New York 14953-1901
*Plant Science Department, South Dakota State University, Brookings, South Dakota 57007, †Biosciences Research Laboratory, U.S.
+
* Department of Plant Biology, Cornell University, Ithaca, New York 14853
*Department of Agriculture–Agricultural Research Service, Fargo, North Dakota 58105, ‡Northern Crop Science Laboratory, U.S.
 
*Department of Agriculture–Agricultural Research Service, Fargo, North Dakota 58102, §National Institute of Agrobiologica
 
*Sciences, Tsukuba, Ibaraki 305-8602, Japan
 
*Agricultural College, Yangzhou University, Yangzhou 225008, China
 
*Department of Plant Breeding and Genetics, Cornell University, Ithaca, New York 14953-1901
 
*Department of Plant Biology, Cornell University, Ithaca, New York 14853
 
*Department of Plant Breeding and Genetics, Cornell University, Ithaca, New York, United States of America
 
*International Rice Research Institute, Los Ban˜ os, Philippines*
 
*Indonesian Center for Agricultural Biotechnology and Genetic Resources Research and Development, Bogor, Indonesia
 
*Department of Agronomy, Chungbuk National University, Chongju, Republic of Korea
 
*National Institute of Agricultural Biotechnology, Suwon, Republic of Korea
 
*Department of Biological Statistics and Computational Biology, Cornell University, Ithaca, New York, United States of America
 
*Plant Genome Research Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki, 305-8602 Japan
 
*QTL Genomics Research Center, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki, 305-8602 Japan
 
*Genetic Diversity Department, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan
 
*Department of Biological Science and Technology, Tokyo University of Science, Noda, Chiba 278-8510, Japan
 
*Research Institute for Biresources, Okayama University, Kurashiki, Okayama 710-0046, Japan
 
*National Agricultural Research Center for Kyushu Okinawa Region, National Agriculture and Bio-oriented Research Organization, Nishigoshi, Kikuchi, Kumamoto 861-1192, Japan
 
*National Institute for Basic Biology, Okazaki, Aichi 444-8585, Japan
 
*Plant Breeding Laboratory, Graduate School of Agriculture, Hokkaido University, Sapporo, Hokkaido 060-8589, Japan
 
 
 
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="ref1">Xing-You Gu; Michael E. Foley; David P. Horvath; James V. Anderson; Jiuhuan Feng; Lihua Zhang; Chase R. Mowry; Heng Ye; Jeffery C. Suttle; Koh-ichi Kadowaki; Zhongxiang Chen.  Association Between Seed Dormancy and Pericarp Color Is Controlled by a Pleiotropic Gene That Regulates Abscisic Acid and Flavonoid Synthesis in Weedy Red Rice;Genetics, 2011, 189(4): 1515-1524.</ref>
+
* <ref name="ref1">
<ref name="ref2">B. L. GROSS, F. T. STEFFEN, K. M. OLSEN The molecular basis of white pericarps in African domesticated rice: novel mutations at the Rc gene.Journal of Evolutionary Biology, 2010, 23(12): 2747-2753.</ref>
+
Sweeney M T, Thomson M J, Pfeil B E, et al. Caught red-handed: Rc encodes a basic helix-loop-helix protein conditioning red pericarp in rice[J]. The Plant Cell, 2006, 18(2): 283-294.
<ref name="ref3">Saeko Konishi, Kaworu Ebana and Takeshi Izawa Inference of the japonica Rice Domestication Process from the Distribution of Six Functional Nucleotide Polymorphisms of Domestication-Related Genes in Various Landraces and Modern Cultivars Plant and Cell Physiology, 2008, 49(9): 1283-1293.</ref>
+
</ref>
<ref name="ref4">Megan T. Sweeney; Michael J. Thomson; Yong Gu Cho; Yong Jin Park; Scott H. Williamson; Carlos D. Bustamante; Susan R. McCouch Global Dissemination of a Single Mutation Conferring White Pericarp in Rice PLoS Genetics, 2007, 3(8): 1418-1424.</ref>
 
<ref name="ref5">Tsutomu Furukawa, Masahiko Maekawa, Tomoyuki Oki, Ikuo Suda, Shigeru Iida, Hiroaki Shimada, Itsuro Takamure, Koh-ichi Kadowaki The Rc and Rd genes are involved in proanthocyanidin synthesis in rice pericarp The Plant Journal, 2006, 49(1): 91-102.</ref>
 
<ref name="ref6">Megan T. Sweeney, Michael J. Thomson, Bernard E. Pfeil, Susan McCouch Caught Red-Handed: Rc Encodes a Basic Helix-Loop-Helix Protein Conditioning Red Pericarp in Rice The Plant Cell, 2006, 18(2): 283-294.</ref>
 
 
</references>
 
</references>
 +
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 07]]
GeneName = Os07g0211500|
 
Description = Pericarp Color;red grain color gene|
 
Version = DQ204735.1  GI:78057266|
 
Length = 833bp|
 
Definition = Oryza sativa (japonica cultivar-group) cultivar H75 brown pericarp
 
            and seed coat (Rc) gene, complete cds.|
 
Source = Oryza sativa Japonica Group (Japanese rice)
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7|
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:19856181..19857859
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq> 1 atggccggcg gcgaggcgca tgcggcgctg caggcggtgg cgcagagcct ccggtggacc
 
      61 tacagcctcc tctggcagct ctgcccccac caagggagctcg
 
      421 ctggtgtggg gggaggggca ctacaacggc gccgtcaaga cgcggaagtc gacggtgatg
 
      481 cagccgccgc cggcggagga ggaggacgac gccgaccacg cggcgcgcca ccggagccgg
 
      541 cagctgaggg agctctacga ctggctgcag caggccgggg agaactccag cggcggcgtg
 
      601 cagacgtcgt cgacgacggc gagccggcgg ccgggggcgg ctctgtcgcc ggaggacctg
 
      661 acggagacgg agtggttctt cctcatgtcg gcatcctact ccttccctcc cggcatcgggtta
 
    3421 cctggaaggg catttgcaag gagaggccat gtatggctca ctggagcaaa tgaagttgac
 
    3481 agcaaagtat tcctaagagc aattcttgcc aagacagttgtg tgcattcctg ttgtcgatgg cgtcctggaa attggaacta cggaaaaggtggaggaag atatgggcct gattcagtat gcaaggggca
 
    4201 tcttcatgga tcaacatggc atccacatga agcctaccct ctcacagcac tcaacatcca
 
    4261 acccagtcac ccactgtact catcagcatc caatccaggt tcagatgcaa ctaggtatca
 
    4321 ccagccaaac aaagtttgat tattcagatg agctcaatgc agatgaggag aatgatgaca
 
    4381 cagaagaaga gggcatgtca ggttcagaca ctaacaacac tgacactgaa aggaattcag
 
    4441 gccagctgca acttcaaatg caagaccaac tgaacatggt gagcaatgac caccagacaa
 
    4501 taccaaataa tgcagtttcc agtgagctaa tgcagtgtga gatgtcagaa gtggtaagag
 
    4561 atggctgctc aaataatatt ttagaggatg aaatccaaat gctgatggat tgccaaaaca
 
    4621 gtaattgtca gttaaatttg caagggccag atgagccttg tcactcttgg cattttctct
 
    4681 gcgaggagtt acaaaatgat taccagccagctactgaaga tcaagtggca tcacctgaaa atacccatta
 
    4921 cccaaaaaca ctcatgacaa tcctacatta caacacgctg cgacagcaag agatgaacat
 
    4981 caagaactac ttgccagttt cagagaaatc atcattctcc agatggacta ctcctgaagg
 
    5041 aagtgatgac aacaagacca tgatcagtcc aggcaccaca cagagaatgc tcaagagcat
 
    5101 cctgatgatt gttcccagta gtcactgcag ttacagggga gcagaaacac ctgaatcaag
 
    5161 gggcgggaaa ggcgcaagtg gaacgcgaaa agtcggtgcc atccaaggtg atttcagtgc
 
    5221 caaccatgtg ctgaaagaga ggagaagaag agagaagctc aatgagaagt tcataattct
 
    5281 gcgatctttg gtacctttca tgacaaagatggac aaggcgtcga tactaggcga
 
    6001 cacgatcgag tacgtgaagc agctaaggaa ccgcatacaa gagctcgagt cgtcgtcgtc
 
    6061 gtcgtcacga gcagccgccc gggcgccatc ggcggcggcc gccgggaggc ggaggaagag
 
    6121 atccgccgcc gccgccactg ccacggcggc ggaagggatg agcagcagca atggccgcaa
 
    6181 tggcggcgag gcggcggagg tggtgcaggt gtccatcatc gagagcgacg cgctgctgga
 
    6241 gctccggtgc ggttgcggcg gcggcggcgg cggtgtggtg ctgctccggg tgatgcaggc
 
    6301 gatgcaggag ctccagctgg aggtcaccgc cgtccaggcc tcgtgcgccg gtggcgagct
 
    6361 gctcgccgag ctgcgcgcca aggtcgtcgt tatgatcctg atctgcatga aaatgcaaat
 
    6421 gcaaatgcaa atgcagaatt aa</cdnaseq>|
 
AA = <aaseq>MAGGEAHAALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNG
 
                    AVKTRKSTVMQPPPAEEEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTAS
 
                    RRPGAALSPEDLTETEWFFLMSASYSFPPGIGLPGRAFARRGHVWLTGANEVDSKVFL
 
                    RAILAKTVVCIPVVDGVLEIGTTEKVEEDMGLIQYARGIFMDQHGIHMKPTLSQHSTS
 
                    NPVTHCTHQHPIQVQMQLGITSQTKFDYSDELNADEENDDTEEEGMSGSDTNNTDTER
 
                    NSGQLQLQMQDQLNMVSNDHQTIPNNAVSSELMQCEMSEVVRDGCSNNILEDEIQMLM
 
                    DCQNSNCQLNLQGPDEPCHSWHFLCEELQNDYQPATEDQVASPENTHYPKTLMTILHY
 
                    NTLRQQEMNIKNYLPVSEKSSFSRWTTPEGSDDNKTMISPGTTQRMLKSILMIVPSSH
 
                    CSYRGAETPESRGGKGASGTRKVGAIQGDFSANHVLKERRRREKLNEKFIILRSLVPF
 
                    MTKMDKASILGDTIEYVKQLRNRIQELESSSSSSRAAARAPSAAAAGRRRKRSAAAAT
 
                    ATAAEGMSSSNGRNGGEAAEVVQVSIIESDALLELRCGCGGGGGGVVLLRVMQAMQEL
 
                    QLEVTAVQASCAGGELLAELRAKVVVMILICMKMQMQMQMQN"</aaseq>|
 
DNA = <dnaseqindica>1321..1386#668..1152#450..531# 1 atggccggcg gcgaggcgca tgcggcgctg caggcggtgg cgcagagcct ccggtggacc
 
      61 tacagcctcc tctggcagct ctgcccccac caagggtacc taccctacct acctacgaca
 
      121 cgatgcacag tgttcatcca tggccggcca tggcggatcg tcgtcgttgt cgatgatcat
 
      181 cgaaggaagc tagaggatat ggctcaatac tttgataata tatatactga tctctccgta
 
      241 caacaaaaat ataaaaattc tagctagtat cgaatgagac atatgctatg ctagtactac
 
      301 gaatctaaaa agatgtacat attttgattc gtattattag gatatatcac gagtttttat
 
      361 attttgagac ggatgtaata attctgaatt tagttgtgat ccatggcatg caggagctcg
 
      421 ctggtgtggg gggaggggca ctacaacggc gccgtcaaga cgcggaagtc gacggtgatg
 
      481 cagccgccgc cggcggagga ggaggacgac gccgaccacg cggcgcgcca ccggagccgg
 
      541 cagctgaggg agctctacga ctggctgcag caggccgggg agaactccag cggcggcgtg
 
      601 cagacgtcgt cgacgacggc gagccggcgg ccgggggcgg ctctgtcgcc ggaggacctg
 
      661 acggagacgg agtggttctt cctcatgtcg gcatcctact ccttccctcc cggcatcggg
 
      721 tatataataa aaaatataga tataaatatt taagcatgca tgcataaatt aaaccacact
 
      781 tcttgttacg tgttcttggc aaaatgatga acaattacca ctaattaatt ggagccagaa
 
      841 accctaaaga tttacccacc tggttaatta atcggtgtgt tgatccacgc atgcatgcat
 
      901 gcagaaaatc aagatcagga tagctccttt tcttttgcag gttaattagc tagatcttca
 
      961 cgtataatta gctagctaga ttttaaaata taatttattc aatttgattt atgattttta
 
    1021 ttttttattt caaatagata caactgtata caaaatttta ttttggtaca tacctccgat
 
    1081 ccaactacat cagaggtaaa aaaaaaatta aaccgttgga attgattaga acaagatcgt
 
    1141 gcggtcaaat tatatcataa ctaacttttc tgattctcta aagcatagag atgtatatat
 
    1201 acatcgtatt attaggctct atatttcctg attaacacta gatgcatata taattttgat
 
    1261 agtcaaaata tacttttgat aggctctaaa gaaaaactta ataacatgta ctccctccat
 
    1321 atacttttga tagtcatatt tcatcttgac acacagatca agtataagta attctactta
 
    1381 tcatccattt aaacacgcta ctagttattc ctcataaaca agcgattcat taatatttac
 
    1441 atttctcgat gcttgtgtag ccaatattgt gtggaagaat ggaatgtcat taagaggata
 
    1501 ggttgttgga ttgaaatatg cctatcaaaa ataaattttt agatttgaaa atatgcctat
 
    1561 caaaagtaga tggagggagt attaattaat gtgaatttcc aatcctactg ttgtgatatt
 
    1621 aggctttgta ccttcttgtc caggaggtat atatatggct cttttaagga tgggagaaaa
 
    1681 tatcatcttt aatacaacta tatatggctt ttgtttgata aatacaactt ttattttgta
 
    1741 tgaatacaaa tatattgata aatatccacc attataatcc taacccatta ggatcatatg
 
    1801 gtgtatattt ttttaactat ttgtttttta taaattaata ttaagagatc acaataaaaa
 
    1861 tatagtatta tgaaagtact cttaacaaca tatccaatga taaaattatt attattacaa
 
    1921 aatatagtgg tcaaattgta tagaattcaa tagcctgatt ttatgacgtc aagtaaatta
 
    1981 aataaagaat gaaggtagtg ctagagtgat caaacaatat ctctcctaaa atatgtccta
 
    2041 taagttttac tccataaatc caagggtcaa aagttgttgg gttatttttt tagataataa
 
    2101 catactaccc cttttcaaaa tgtatgattc tattgacttt ttgcacaaca tttaaccatt
 
    2161 tgtcatatta aaaattagta taaacatcta aaaatataag ttacaattat attttatttg
 
    2221 atgataaaac aactcacaac aaaataaata atatttatat aatctttttg gaataaaacg
 
    2281 aatgatcaaa cattattcaa aaagtcaatg gtatagtacg ttttgaaatt gatagactat
 
    2341 gagagcaaaa ttttgagata acatggaaaa ttatcctctt agacattgca ctgtgtaata
 
    2401 attaataata atgaatgaaa ggctaagact tttcttccac cttatataag tggttgaata
 
    2461 tatagcaatc acatcattac atgattttgt aaccaaccgt ctctatagct ccgatacagt
 
    2521 gctagtttca catcgtaata attaaagagt ataataataa atcgaggtgt acttctcatc
 
    2581 gatgaagtga tgtgccgctt agctaaatta aactcgtatg cgaaaaatca gtatatgtcc
 
    2641 ggttaatttc taagagagag attgagagag aataattgcg cccctccaaa tccccctctt
 
    2701 ggacgttagg gagctatata gacggtattg ctaagtgcga tgtgtacata acgtacctgt
 
    2761 cgtaggaaca tttctcatcc aaattaagta gtaatgcatg gcatgaaatc catttttgta
 
    2821 ttttgcatgg caaagaatga caacaaggaa tacactagct agccctgccc tttttcaatt
 
    2881 taatttaaca tcaaacttag ttattgtatt tcttttgtca gaatagcatg cattgcatac
 
    2941 tctttaaaaa taattaatta gtgtatttta ctagtcttac aaaagtatca agagagacaa
 
    3001 ctaattatag ttgggagaca ccaaacttgt ttttaataat gacaattaaa accctacctc
 
    3061 tacatccaac atagacgtac atagtccgaa ggcgccaaat atttgtacat ttagctacca
 
    3121 gatttcagta cgagttctca cattataatt ttgatttttt tatttttttt ataaacaatc
 
    3181 tggtaccctt ttatgtctgg aaggaaaaaa aaaatctaaa ttgcaacatt ttagtcggtg
 
    3241 agaatggtac tctgtcctag ctactttcta cacatgagag agagagagag agagagagag
 
    3301 agagccttta attgcccttg cccatgcatc tttctttgca cacatgtatg cttttcacat
 
    3361 tgtcatgagg agagaacttg ttaagttgca cacatgtgtg ctttgcatgt cttcaggtta
 
    3421 cctggaaggg catttgcaag gagaggccat gtatggctca ctggagcaaa tgaagttgac
 
    3481 agcaaagtat tcctaagagc aattcttgcc aaggttcagc catcaccttc tcttacctat
 
    3541 ttttcactct gaatgccaac agtgctttgc acattgtagt ctgtttgcag actgcaaatg
 
    3601 atgaccataa tcagatcaga aaataaaata atattatata ctttttgagc cagctagcaa
 
    3661 gaatatgtaa caataattct cctttttttt tcttgttctt ttccctgatg tggtgcataa
 
    3721 caaataacca aactgatgaa tggcagagtg ctggtatcca ggtatttgcc tctaaaagta
 
    3781 gctacacgtt tactatgaaa ttttgtggct tttgttcatc tttggatgca gtggccatta
 
    3841 tctaaaaact atgaatttcc agactgcagt ttttatctaa ttttgtgact ttgtacatca
 
    3901 gacagttgtg tgcattcctg ttgtcgatgg cgtcctggaa attggaacta cggaaaaggt
 
    3961 gatttcgtat attatcagct gacaatctaa ttatatgggc catataatta agtataaatc
 
    4021 aaaatacctc ataatatatt ataaagtatc taatgtgatt atgtgaatat tggctatttc
 
    4081 aatgtaattt gatatatgaa actgataatc ctctgaaact ccgtaaggat caaactaatc
 
    4141 aaaatgtata tattttcaag gtggaggaag atatgggcct gattcagtat gcaaggggca
 
    4201 tcttcatgga tcaacatggc atccacatga agcctaccct ctcacagcac tcaacatcca
 
    4261 acccagtcac ccactgtact catcagcatc caatccaggt tcagatgcaa ctaggtatca
 
    4321 ccagccaaac aaagtttgat tattcagatg agctcaatgc agatgaggag aatgatgaca
 
    4381 cagaagaaga gggcatgtca ggttcagaca ctaacaacac tgacactgaa aggaattcag
 
    4441 gccagctgca acttcaaatg caagaccaac tgaacatggt gagcaatgac caccagacaa
 
    4501 taccaaataa tgcagtttcc agtgagctaa tgcagtgtga gatgtcagaa gtggtaagag
 
    4561 atggctgctc aaataatatt ttagaggatg aaatccaaat gctgatggat tgccaaaaca
 
    4621 gtaattgtca gttaaatttg caagggccag atgagccttg tcactcttgg cattttctct
 
    4681 gcgaggagtt acaaaatgat taccagccag gtattacatt tgagaagata atccttcaaa
 
    4741 agcacccttg ttccaaaaat atatatttgt actcttcaca caagcactgc catttttttt
 
    4801 cttttttgca tacatcctca attcttgcat ttcttttcca tatatttgat acaactgtct
 
    4861 ccatttccct tctgtcacag ctactgaaga tcaagtggca tcacctgaaa atacccatta
 
    4921 cccaaaaaca ctcatgacaa tcctacatta caacacgctg cgacagcaag agatgaacat
 
    4981 caagaactac ttgccagttt cagagaaatc atcattctcc agatggacta ctcctgaagg
 
    5041 aagtgatgac aacaagacca tgatcagtcc aggcaccaca cagagaatgc tcaagagcat
 
    5101 cctgatgatt gttcccagta gtcactgcag ttacagggga gcagaaacac ctgaatcaag
 
    5161 gggcgggaaa ggcgcaagtg gaacgcgaaa agtcggtgcc atccaaggtg atttcagtgc
 
    5221 caaccatgtg ctgaaagaga ggagaagaag agagaagctc aatgagaagt tcataattct
 
    5281 gcgatctttg gtacctttca tgacaaaggt aattaagtac tccctctatt tctataaagc
 
    5341 cgtatttgac tagttatctt atttagaaag tatgtgcaaa tatgtaaaat ataagtcata
 
    5401 cttaaagaac ttttaatgtt attaaataat aagtcacacc aaaaataaaa catatatatt
 
    5461 tttaataaga caaatgatta aatgtatata taaaaattaa tagcgtcaca tattttaaaa
 
    5521 tagaggggta tttaagtacc cacaggatca tcaaaattca gttatctttt cttaagcctc
 
    5581 taacgaacat tggaagatcc tcactaatgg cagcatgaat ctagggttca ctatttcgga
 
    5641 atgcaaaata tgttttaccg ggcatccgat ttttaaaaaa ttcagaatga agaaaattga
 
    5701 atctttttta tggatttgaa taaatcttga taaattcgaa aaaatttccg aacttttggc
 
    5761 cagaagtgaa tcctacccgt atccaccggt aataaaccta aatttttggg agtaatgaat
 
    5821 taatgttata tataatccat gaattatata gttccaaact actccgtaac aaattttcag
 
    5881 gagtagtgaa attaatatta ttacaatctc agaaaaaaat ggcagaaaca attaatctgt
 
    5941 tttcaattat taattaattt gtttttgtgt ccagatggac aaggcgtcga tactaggcga
 
    6001 cacgatcgag tacgtgaagc agctaaggaa ccgcatacaa gagctcgagt cgtcgtcgtc
 
    6061 gtcgtcacga gcagccgccc gggcgccatc ggcggcggcc gccgggaggc ggaggaagag
 
    6121 atccgccgcc gccgccactg ccacggcggc ggaagggatg agcagcagca atggccgcaa
 
    6181 tggcggcgag gcggcggagg tggtgcaggt gtccatcatc gagagcgacg cgctgctgga
 
    6241 gctccggtgc ggttgcggcg gcggcggcgg cggtgtggtg ctgctccggg tgatgcaggc
 
    6301 gatgcaggag ctccagctgg aggtcaccgc cgtccaggcc tcgtgcgccg gtggcgagct
 
    6361 gctcgccgag ctgcgcgcca aggtcgtcgt tatgatcctg atctgcatga aaatgcaaat
 
    6421 gcaaatgcaa atgcagaatt aa
 
</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/78057269]|
 
}}
 
[[Category:Genes]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 7]]
 
[[Category:Chromosome 7]]
 

Latest revision as of 15:25, 21 December 2016

The rice gene Os07g0211500 was reported as Rc in 2006[1] by researchers from USA.

Annotated Information

Gene Symbol

  • Os07g0211500 <=> Rc, OsbHLH017, OsbHLH17, SD7-1, qSD7-1/qPC7, OsGL3C, GL3C

Function

Rc allele phenotypes. [1].
  • Rc is a domestication-related gene required for red pericarp in rice (Oryza sativa).
  • Rc encodes a basic helix-loop-helix (bHLH) protein that was fine-mapped to an 18.5-kb region on rice chromosome 7 using a cross between Oryza rufipogon (red pericarp) and O. sativa cv Jefferson (white pericarp).
  • Rc is a positive regulator of proanthocyanidin.


Expression

  • Rc gene was expressed in both red- and white-grained rice but that a shortened transcript was present in white varieties.

Evolution

Figure 5. Phylogenetic Analysis of Rc and Other bHLH Proteins. [1].

You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Plant Breeding and Genetics, Cornell University, Ithaca, New York 14953-1901
  • Department of Plant Biology, Cornell University, Ithaca, New York 14853

References

  1. 1.0 1.1 1.2 Sweeney M T, Thomson M J, Pfeil B E, et al. Caught red-handed: Rc encodes a basic helix-loop-helix protein conditioning red pericarp in rice[J]. The Plant Cell, 2006, 18(2): 283-294.


Structured Information