Difference between revisions of "Os03g0322900"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0322900| Description = Apolipoprotein/apolipophorin domain containing protein| Version = NM_001056505.2 GI:297600839 GeneID:4332688| Length...")
 
(Subcellular localization)
 
(15 intermediate revisions by 4 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os03g0322900''''' was reported as '''''OsLEA3-2''''' in 2012 <ref name="ref1" /> by researchers from China.
GeneName = Os03g0322900|
+
 
Description = Apolipoprotein/apolipophorin domain containing protein|
+
==Annotated Information==
Version = NM_001056505.2 GI:297600839 GeneID:4332688|
+
[[File:Os03g0322900-1.png|right|thumb|400px|'''Figure 5.''' ''Effect of osmotic or salinity stress on Arabidopsis seedlings from wild type and OsLEA3-2 -overexpressing transgenic lines (L35, L48, and L69).(C, D) Sorbitol or NaCl sensitivity of wild type or transgenic seedlings. Photographs were taken following 9 days of growth on media containing 0 (control), 200 mM sorbitol, or 100 mM NaCl.<ref name="ref1" />.'']]
Length = 1373 bp|
+
===Gene Symbol===
Definition = Oryza sativa Japonica Group Os03g0322900, complete gene.|
+
*'''''Os03g0322900''''' '''''<=>''''' '''''OsLEA17''''','''''OsLEA3-2''''','''''LEA3-2'''''
Source = Oryza sativa Japonica Group
+
===Function===
 +
*The rice gene '''''OsLEA3-2''''' is an Abiotic Stress Induced Gene of Rice, which Plays a Key Role in Salt and Drought Tolerance<ref name="ref1"/>.
 +
* Late embryogenesis abundant (LEA) proteins are involved in tolerance to drought, cold and high salinity in many different organisms<ref name="ref1"/>.
 +
* In vitro analysis showed that '''''OsLEA3-2''''' was able to protect LDH from aggregation on freezing and inactivation on desiccation.
 +
 
 +
===Mutation===
 +
* The transgenic Arabidopsis seedlings showed better growth on MS media supplemented with 150 mM mannitol or 100 mM NaCl as compared with wild type plants. The transgenic rice also showed significantly stronger growth performance than control under salinity or osmotic stress conditions and were able to recover after 20 days of drought stress.
 +
 
 +
===Expression===
 +
*Expression of the ''Os03g0322900'' gene was '''strongly''' and '''consistently induced''' in '''Fe-deficient leaves''', and was '''moderately induced''' in '''Fe-deficient roots''' in one of the two sets of experiments<ref name="ref2"/>.
 +
 
 +
*''OsLEA3-2'' does not express in vegetative tissues under normal conditions, but was found to be '''only expressed in the embryo''' and can be induced by abiotic stresses. While '''no transcript''' was detected in the seedlings treated with low temperature stress or ABA, ''OsLEA3-2'' expression was detected when the rice was grown in Hoagland with ABA. ''OsLEA3-2'' was '''induced by the ABA''', but assimilation was not possible through a topographical application on rice leaves. '''Mannitol and salt stress''' also '''induced''' ''OsLEA3-2'' gene expression in the '''shoot base''' and '''leaves''', while the '''PEG treatment induced''' gene expression in '''both roots and shoots'''<ref name="ref1"/>.
 +
 
 +
*''OsLEA3-2'' was also '''inserted into pHB vector''' and overexpressed in ''Arabidopsis'' and rice. Overexpression of ''OsLEA3-2'' in yeast '''improved growth performance''' compared with control '''under salt- and osmotic-stress''' conditions<ref name="ref1"/>.
 +
 
 +
===Subcellular localization===
 +
[[File:Os03g0322900-2.png|right|thumb|400px|'''Figure 3.''' '''Subcellular localization of OsLEA3-2.'''<ref name="ref1"/>.]]
 +
 
 +
===Evolution===
 +
* The deduced amino acid sequence shares '''42%''' and '''36% amino acid identities''' with ''LEA3'' of ''Arabidopsis thaliana'' and ''Oryza sativa'', respectively. Predicted proteins of Oryza ''LEA3-2'' showed a preponderance of Ala, Thr, Asp, Glu, Lys, Arg and Gly that constitute 20.6%, 10.2%, 10%, 9.3%, 9.3%, 9.3%, and 7.3%, respectively, and lack Trp. ''OsLEA3-2'' has 16 11-mer repeating units, TKDA(A/T)ADK(A/T)RE.
 +
* Hydropathy analysis showed that ''OsLEA3-2'' is a '''hydrophilic protein'''<ref name="ref1"/>.
 +
 
 +
===Knowledge Extension===
 +
*Late embryogenesis abundant (LEA) proteins are involved in tolerance to drought, cold and high salinity in many different organisms. A cDNA clone oslea3, encoding a group 3 late-embryogenesis abundant (LEA) protein was isolated from roots of rice seedlings (''Oryza sativa L.''). The encoded ''OSLEA3'' protein has previously been found to accumulate to higher levels in roots of two salttolerant compared to a salt-sensitive rice variety in response to abscisic acid (ABA)<ref name="ref3"/>.
 +
 
 +
*Because of the abundance of LEA proteins in desiccation-tolerant embryos of mature seeds and for their unusual structural characteristics an involvement in the acquisition of dehydration tolerance had been proposed<ref name="ref1"/>.
 +
 
 +
==Labs working on this gene==
 +
* Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China
 +
* Graduate University of the Chinese Academy of Sciences, Beijing, People’s Republic of China
 +
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Duan J, Cai W. OsLEA3-2, an abiotic stress induced gene of rice plays a key role in salt and drought tolerance[J]. PLoS One, 2012, 7(9): e45117.
 +
</ref>
 +
* <ref name="ref2">
 +
Kobayashi T, Itai R N, Ogo Y, et al. The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes[J]. The Plant Journal, 2009, 60(6): 948-961.
 +
</ref>
 +
* <ref name="ref3">
 +
Moons A, De Keyser A, Van Montagu M. A group 3 LEA cDNA of rice, responsive to abscisic acid, but not to jasmonic acid, shows variety-specific differences in salt stress response[J]. Gene, 1997, 191(2): 197-204.</ref>
 +
</references>
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:11749963..11751335|
 
CDS = 11750482..11751243|
 
GCID = <gbrowseImage1>
 
name=NC_008396:11749963..11751335
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:11749963..11751335
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgtcgaggcaggacaggagggaggcgcgggccgaggccgacgcgcggcgcgcggcggaggagatcgcgcgggcgcgggacgagcgcgtcatgcaggcggaggtggacgcccggtcggccgcggacgagatcgcccgcgcccgcgccgaccgcggcgccgccacgatgggcgccgacaccgcccaccacgccgccggcggcggcggcatcctggagagcgtgcaggagggcgccaagtcgttcgtgagcgccgtcgggcgcacgttcggcggcgcgagggacaccgccgcggagaagacctcccagacggcggacgccacccgggacaagctcggcgagtacaaggactacaccgccgacaaggcccgcgagaccaacgacagcgtcgcgcggaagacgaacgagacggcggacgcctcccgtgacaagctcggcgagtacaaggactacaccgccgacaagacccgggagaccaaggacgccgtggcgcagaaggcgagcgacgcctccgaggcgaccaagaacaagctgggcgagtacaaggacgcgctggccaggaagacgcgcgacgccaaggacaccaccgcgcagaaggcgacggagttcaaggacggcgtgaaggcgacggcgcaggagacgagggacgccaccgccgacacggcgaggaaggccaaggacgccaccaaggacaccacccagaccgccgccgacaaggccagggagacggccgccacccacgacgacgccaccgacaagtaa</cdnaseq>|
 
AA = <aaseq>MASRQDRREARAEADARRAAEEIARARDERVMQAEVDARSAADE                    IARARADRGAATMGADTAHHAAGGGGILESVQEGAKSFVSAVGRTFGGARDTAAEKTS                    QTADATRDKLGEYKDYTADKARETNDSVARKTNETADASRDKLGEYKDYTADKTRETK                    DAVAQKASDASEATKNKLGEYKDALARKTRDAKDTTAQKATEFKDGVKATAQETRDAT                    ADTARKAKDATKDTTQTAADKARETAATHDDATDK</aaseq>|
 
DNA = <dnaseqindica>93..854#actcgtgcactgcgaagctacacttaccactgcaaccactgatcacagagctagaggttcacttaggcgaagcttaattacacagagcgcccatggcgtcgaggcaggacaggagggaggcgcgggccgaggccgacgcgcggcgcgcggcggaggagatcgcgcgggcgcgggacgagcgcgtcatgcaggcggaggtggacgcccggtcggccgcggacgagatcgcccgcgcccgcgccgaccgcggcgccgccacgatgggcgccgacaccgcccaccacgccgccggcggcggcggcatcctggagagcgtgcaggagggcgccaagtcgttcgtgagcgccgtcgggcgcacgttcggcggcgcgagggacaccgccgcggagaagacctcccagacggcggacgccacccgggacaagctcggcgagtacaaggactacaccgccgacaaggcccgcgagaccaacgacagcgtcgcgcggaagacgaacgagacggcggacgcctcccgtgacaagctcggcgagtacaaggactacaccgccgacaagacccgggagaccaaggacgccgtggcgcagaaggcgagcgacgcctccgaggcgaccaagaacaagctgggcgagtacaaggacgcgctggccaggaagacgcgcgacgccaaggacaccaccgcgcagaaggcgacggagttcaaggacggcgtgaaggcgacggcgcaggagacgagggacgccaccgccgacacggcgaggaaggccaaggacgccaccaaggacaccacccagaccgccgccgacaaggccagggagacggccgccacccacgacgacgccaccgacaagtaaactcgccggaacaccatccgcaagcacgtagtgctcctagctatcgataataatgtccacattttttttgttgatgatgcagggggcaagggcagggcctgctcggggcgctggggaacgtgacgggggcgatcaaggagaagctgacggtgagcccggcggcgacgcaggagcatctgggcggcggcgaggagcgcgcggtgaaggagcgcgcggcggagaaggcggcgtcggtgtacttcgaggagaaggaccggctgacgagggagcgcgcggcggagcgggtggacaagtgcgtggagaagtgcgtcgaggggtgccccgacgccacctgcgcccaccgccacggcaagatgtgatcccccatgagcgcggtggacgactaataaaaaaaactcccagcatgttaacctttgtgtttcaagtttcactagctgcttttattttgctttcgttaagtttccactaccgtgtatgttccttctggtaatctaagtgcagtggtgctgaaatctttat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056505.2 RefSeq:Os03g0322900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:05, 13 February 2017

The rice Os03g0322900 was reported as OsLEA3-2 in 2012 [1] by researchers from China.

Annotated Information

Figure 5. Effect of osmotic or salinity stress on Arabidopsis seedlings from wild type and OsLEA3-2 -overexpressing transgenic lines (L35, L48, and L69).(C, D) Sorbitol or NaCl sensitivity of wild type or transgenic seedlings. Photographs were taken following 9 days of growth on media containing 0 (control), 200 mM sorbitol, or 100 mM NaCl.[1].

Gene Symbol

  • Os03g0322900 <=> OsLEA17,OsLEA3-2,LEA3-2

Function

  • The rice gene OsLEA3-2 is an Abiotic Stress Induced Gene of Rice, which Plays a Key Role in Salt and Drought Tolerance[1].
  • Late embryogenesis abundant (LEA) proteins are involved in tolerance to drought, cold and high salinity in many different organisms[1].
  • In vitro analysis showed that OsLEA3-2 was able to protect LDH from aggregation on freezing and inactivation on desiccation.

Mutation

  • The transgenic Arabidopsis seedlings showed better growth on MS media supplemented with 150 mM mannitol or 100 mM NaCl as compared with wild type plants. The transgenic rice also showed significantly stronger growth performance than control under salinity or osmotic stress conditions and were able to recover after 20 days of drought stress.

Expression

  • Expression of the Os03g0322900 gene was strongly and consistently induced in Fe-deficient leaves, and was moderately induced in Fe-deficient roots in one of the two sets of experiments[2].
  • OsLEA3-2 does not express in vegetative tissues under normal conditions, but was found to be only expressed in the embryo and can be induced by abiotic stresses. While no transcript was detected in the seedlings treated with low temperature stress or ABA, OsLEA3-2 expression was detected when the rice was grown in Hoagland with ABA. OsLEA3-2 was induced by the ABA, but assimilation was not possible through a topographical application on rice leaves. Mannitol and salt stress also induced OsLEA3-2 gene expression in the shoot base and leaves, while the PEG treatment induced gene expression in both roots and shoots[1].
  • OsLEA3-2 was also inserted into pHB vector and overexpressed in Arabidopsis and rice. Overexpression of OsLEA3-2 in yeast improved growth performance compared with control under salt- and osmotic-stress conditions[1].

Subcellular localization

Figure 3. Subcellular localization of OsLEA3-2.[1].

Evolution

  • The deduced amino acid sequence shares 42% and 36% amino acid identities with LEA3 of Arabidopsis thaliana and Oryza sativa, respectively. Predicted proteins of Oryza LEA3-2 showed a preponderance of Ala, Thr, Asp, Glu, Lys, Arg and Gly that constitute 20.6%, 10.2%, 10%, 9.3%, 9.3%, 9.3%, and 7.3%, respectively, and lack Trp. OsLEA3-2 has 16 11-mer repeating units, TKDA(A/T)ADK(A/T)RE.
  • Hydropathy analysis showed that OsLEA3-2 is a hydrophilic protein[1].

Knowledge Extension

  • Late embryogenesis abundant (LEA) proteins are involved in tolerance to drought, cold and high salinity in many different organisms. A cDNA clone oslea3, encoding a group 3 late-embryogenesis abundant (LEA) protein was isolated from roots of rice seedlings (Oryza sativa L.). The encoded OSLEA3 protein has previously been found to accumulate to higher levels in roots of two salttolerant compared to a salt-sensitive rice variety in response to abscisic acid (ABA)[3].
  • Because of the abundance of LEA proteins in desiccation-tolerant embryos of mature seeds and for their unusual structural characteristics an involvement in the acquisition of dehydration tolerance had been proposed[1].

Labs working on this gene

  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China
  • Graduate University of the Chinese Academy of Sciences, Beijing, People’s Republic of China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Duan J, Cai W. OsLEA3-2, an abiotic stress induced gene of rice plays a key role in salt and drought tolerance[J]. PLoS One, 2012, 7(9): e45117.
  2. Kobayashi T, Itai R N, Ogo Y, et al. The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes[J]. The Plant Journal, 2009, 60(6): 948-961.
  3. Moons A, De Keyser A, Van Montagu M. A group 3 LEA cDNA of rice, responsive to abscisic acid, but not to jasmonic acid, shows variety-specific differences in salt stress response[J]. Gene, 1997, 191(2): 197-204.

Structured Information