Difference between revisions of "Os03g0315400"

From RiceWiki
Jump to: navigation, search
 
(38 intermediate revisions by 6 users not shown)
Line 1: Line 1:
Its gene name ''OsMYB2'', is a R2R3-type MYB gene, expression a MYB-type transcription factor plays a important role in the tolerance to abiotic stress of plants.   
+
The rice '''''Os03g0315400''''' was reported as '''''OsMYB2''''' in 2012 <ref name="ref1" /> by researchers from China.  
 +
    
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg|right|thumb|327px|'''Figure 2.''' ''Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os03g0315400''''' '''<=>''' '''''OsMYB2,MYB2'''''
 
===Function===
 
===Function===
1、Overexpression of ''OsMYB2'' enhanced tolerance to salt cold, and dehydration stress(figure 1).
+
* '''''OsMYB2''''' encodes a stress-responsive MYB transcription factor.
 +
* '''''OsMYB2''''' plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress.
 +
===Phenotypic analysis===
 +
* No difference in growth and development between the OsMYB2-overexpressing and wild-type plants was observed under normal growth conditions, but the OsMYB2-overexpressing plants were more tolerant to salt, cold, and dehydration stresses and more sensitive to abscisic acid than wild-type plants.
 +
* The OsMYB2-overexpressing plants accumulated greater amounts of soluble sugars and proline than wild-type plants under salt stress. Overexpression of OsMYB2 enhanced up-regulation of genes encoding proline synthase and transporters. The OsMYB2-overexpressing plants accumulated less amounts of H2O2 and malondialdehyde.
 +
* The enhanced activities of antioxidant enzymes, including peroxidase, superoxide dismutase, and catalase, may underlie the lower H2O2 contents in OsMYB2-overexpressing plants.
 +
* There was greater up-regulation of stress-related genes, including OsLEA3, OsRab16A, and OsDREB2A, in the OsMYB2-overexpressing plants. Microarray analysis showed that expression of numerous genes involving diverse functions in stress response was altered in the OsMYB2-overexpressing plants.
  
[[File:The tolerance to abiotic of overexpression and RNAi of OsMYB2.jpg]]
+
===Expression===
+
* Expression of '''''OsMYB2''''' was up-regulated by salt, cold, and dehydration stress.
WT:wildtype;
 
OE2 and OE3:  ''OsMYB2'' overexpression strain;
 
Ri1 and Ri3:  ''OsMYB2'' RNAi strain;
 
  
Overexpression of ''OsMYB2'' altered sensitivity of seed germination and growth to salt stress and ABA(figure 2).
+
===Subcellular localization===
 
+
* OsMYB2 was localized in the nucleus with transactivation activity.
[[File:Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg]]
+
[[File:Subcellular localization of OsMYB2.jpg|center|thumb|727px|'''Figure 1.''' ''Subcellular localization and transactivation analysis of OsMYB2.<ref name="ref1" />.'']]
 
 
OsMYB2-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).
 
 
 
[[File:Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg]]
 
 
 
===Expression===
 
Please input expression information here.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* OsMYB2 representative by '''''LOC_Os3g20090''''' ('''''Os03g0315400''''') is belong to C12, and of which are involved in stress response.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China
 +
* Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Yang A, Dai X, Zhang WH. A R2R3-type MYB gene, OsMYB2, is involved in salt,
 +
cold, and dehydration tolerance in rice. J Exp Bot. 2012 Apr;63(7):2541-56. doi:
 +
10.1093/jxb/err431. PubMed PMID: 22301384; PubMed Central PMCID: PMC3346221.
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0315400|
 
Description = Similar to Typical P-type R2R3 Myb protein (Fragment)|
 
Version = NM_001056472.1 GI:115452672 GeneID:4332651|
 
Length = 2127 bp|
 
Definition = Oryza sativa Japonica Group Os03g0315400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:11376759..11378885|
 
CDS = 11377201..11378033,11378520..11378676|
 
GCID = <gbrowseImage1>
 
name=NC_008396:11376759..11378885
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:11376759..11378885
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtga</cdnaseq>|
 
AA = <aaseq>MDMAHERDASSEEEVMGGDLRRGPWTVEEDLLLVNYIAAHGEGR                    WNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQ                    HLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAAGQQ                    QQQEGGTDTPPLSWQHGGSDGLYESPELPAPDASCWPAEYCAAAGGAQSGGTPAPELS                    STTAGSSSLSTDSGAGAQPSWPTQADGAEWFTTACDASSATGGVAMRDTELELAQPPC                    QGGQTWTTSESSLPGLTFPDLAVADFEIGGFDVDSFWTSMEDDQLWCPTQAAV</aaseq>|
 
DNA = <dnaseqindica>853..1685#210..366#agtttcatcgcagcacacatccatccatccatccatctatccagagagcacagcaacggcgcatatatagtacccctctaccaaagcacaacaaccagaatctcctgagctcgatctagctactagcttgatctatccgatcaatcgactggcccgcgaggatcgatcgagactcgaaagggagggattttgatccggatcggtcgacgatggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcaggtaggatcgcgatctcgatcgatcgagctcccaattccaccataaattacatgcacgcacacatcgatcaattccatgagctgagtgtccgtacatgcttagcctgatgagcaattataggacgcaaagtaccagtcgctcttgcatctacatgctgatttctggaaacacagatagctacgagtctaccctgagttctctagcagccaaccagctaagctagaagctatagtgagtgagagggaaaggggagagaatttttagtggttagcagcgtagctagcattgttcatagggatatttttagttgctcatccctcccccgttacatcatccatcctgccgtcgtcgtatgcgtataactgcattagtatataattgattagttgctgcatactatgttttagcaatggtgtactacatgtgaatattttgatgtgacgtgaagagaaaaattaatcttggtttttggttgttgtcatgcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtgaaaagtcagcacggccgccatgggaatccgccgcggcgagcgagcgcgcgcgcgcgcgacacccgcgggtgcacaaccgccggggacgcgtagcggagcggagaagcggattagaagaaggagagaagctatctgggggattagaacaagattaatcgcctcacgatgccatttttggactcctagctcccagactattctaactccagttcttttccgtttctttctccttttttacttcctagggtaaaaaaaaagaagttaaagtgtagccgttatactagtgttgatgctgctgttactaaagtttgtccgttaaattttactcattctttttgagtaaatacagtactgccactactgtatgtacgagctgaactctgtaggattgacaggattactgtacacttctagaaaccggtaataaaagcaaagctccgacg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056472.1 RefSeq:Os03g0315400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 01:53, 14 February 2017

The rice Os03g0315400 was reported as OsMYB2 in 2012 [1] by researchers from China.

Annotated Information

Figure 2. Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.[1].

Gene Symbol

  • Os03g0315400 <=> OsMYB2,MYB2

Function

  • OsMYB2 encodes a stress-responsive MYB transcription factor.
  • OsMYB2 plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress.

Phenotypic analysis

  • No difference in growth and development between the OsMYB2-overexpressing and wild-type plants was observed under normal growth conditions, but the OsMYB2-overexpressing plants were more tolerant to salt, cold, and dehydration stresses and more sensitive to abscisic acid than wild-type plants.
  • The OsMYB2-overexpressing plants accumulated greater amounts of soluble sugars and proline than wild-type plants under salt stress. Overexpression of OsMYB2 enhanced up-regulation of genes encoding proline synthase and transporters. The OsMYB2-overexpressing plants accumulated less amounts of H2O2 and malondialdehyde.
  • The enhanced activities of antioxidant enzymes, including peroxidase, superoxide dismutase, and catalase, may underlie the lower H2O2 contents in OsMYB2-overexpressing plants.
  • There was greater up-regulation of stress-related genes, including OsLEA3, OsRab16A, and OsDREB2A, in the OsMYB2-overexpressing plants. Microarray analysis showed that expression of numerous genes involving diverse functions in stress response was altered in the OsMYB2-overexpressing plants.

Expression

  • Expression of OsMYB2 was up-regulated by salt, cold, and dehydration stress.

Subcellular localization

  • OsMYB2 was localized in the nucleus with transactivation activity.
Figure 1. Subcellular localization and transactivation analysis of OsMYB2.[1].

Evolution

  • OsMYB2 representative by LOC_Os3g20090 (Os03g0315400) is belong to C12, and of which are involved in stress response.

Labs working on this gene

  • State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China
  • Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China

References

  1. 1.0 1.1 1.2 Yang A, Dai X, Zhang WH. A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J Exp Bot. 2012 Apr;63(7):2541-56. doi: 10.1093/jxb/err431. PubMed PMID: 22301384; PubMed Central PMCID: PMC3346221.

Structured Information