Difference between revisions of "Os03g0315400"

From RiceWiki
Jump to: navigation, search
 
(16 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Its gene name ''OsMYB2'', is a R2R3-type MYB gene, expression a MYB-type transcription factor plays a important role in the tolerance to abiotic stress of plants.   
+
The rice '''''Os03g0315400''''' was reported as '''''OsMYB2''''' in 2012 <ref name="ref1" /> by researchers from China.  
 +
    
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg|right|thumb|327px|'''Figure 2.''' ''Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os03g0315400''''' '''<=>''' '''''OsMYB2,MYB2'''''
 
===Function===
 
===Function===
1、Overexpression of ''OsMYB2'' enhanced tolerance to salt cold, and dehydration stress(figure 1).
+
* '''''OsMYB2''''' encodes a stress-responsive MYB transcription factor.
 
+
* '''''OsMYB2''''' plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress.
[[File:The tolerance to abiotic of overexpression and RNAi of OsMYB2.jpg]]The involvement of OsMYB2 in salt, cold, and osmotic
+
===Phenotypic analysis===
stress was investigated by exposing wild-type and the
+
* No difference in growth and development between the OsMYB2-overexpressing and wild-type plants was observed under normal growth conditions, but the OsMYB2-overexpressing plants were more tolerant to salt, cold, and dehydration stresses and more sensitive to abscisic acid than wild-type plants.  
transgenic plants grown in hydroponic solution with NaCl,
+
* The OsMYB2-overexpressing plants accumulated greater amounts of soluble sugars and proline than wild-type plants under salt stress. Overexpression of OsMYB2 enhanced up-regulation of genes encoding proline synthase and transporters. The OsMYB2-overexpressing plants accumulated less amounts of H2O2 and malondialdehyde.  
low temperature, and PEG. There was no difference
+
* The enhanced activities of antioxidant enzymes, including peroxidase, superoxide dismutase, and catalase, may underlie the lower H2O2 contents in OsMYB2-overexpressing plants.  
between transgenic and wild-type plants when grown under
+
* There was greater up-regulation of stress-related genes, including OsLEA3, OsRab16A, and OsDREB2A, in the OsMYB2-overexpressing plants. Microarray analysis showed that expression of numerous genes involving diverse functions in stress response was altered in the OsMYB2-overexpressing plants.
normal, non-stressed conditions in hydroponic solution
 
(Fig. 4A). Phenotypically, most OsMYB2-overexpressing
 
seedlings remained green and showed continuous growth,
 
whereas both wild-type and RNAi seedlings showed severe
 
leaf rolling and wilting after exposure to the salt, cold, and
 
osmotic stress (Fig. 4B-D).
 
 
WT:wildtype;
 
OE2 and OE3:  ''OsMYB2'' overexpression strain;
 
Ri1 and Ri3:  ''OsMYB2'' RNAi strain;
 
 
 
2、Overexpression of ''OsMYB2'' altered sensitivity of seed germination and growth to salt stress and ABA(figure 2).
 
 
 
[[File:Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg]]
 
 
 
3、''OsMYB2''-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).
 
 
 
[[File:Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg]]
 
 
 
4、''OsMYB2''-overexpression plants accumulated less H2O2 and MDA under salt stress(figure 4).
 
 
 
[[File:Effect of salt stress on contents of oxidants (A and B) and antioxidant enzymes (C–D) in wild-type and transgenic rice plants.jpg]]
 
 
 
5、''OsMYB2''-overexpression plants affect some genes' expression profiles. Some genes upregulation can contribute to enhanced tolerance of plants to salt stress and some may involved in stress response.  
 
  
 
===Expression===
 
===Expression===
''OsMYB2'' was detected in roots,shoots,leaves, and flowers, but it was specifically located in the nucleus(figure 5)
+
* Expression of '''''OsMYB2''''' was up-regulated by salt, cold, and dehydration stress.
  
[[File:Subcellular localization of OsMYB2.jpg]]
+
===Subcellular localization===
 
+
* OsMYB2 was localized in the nucleus with transactivation activity.
a、b、c: localization of GFP ;  e、d、f:localization of GFP-OsMYB2
+
[[File:Subcellular localization of OsMYB2.jpg|center|thumb|727px|'''Figure 1.''' ''Subcellular localization and transactivation analysis of OsMYB2.<ref name="ref1" />.'']]
 
 
The response of OsMYB2 expression to salt, cold, and
 
dehydration stress was monitored by real-time RT-PCR.
 
An increase in the OsMYB2 transcript was observed after
 
30 min of exposure to salt stress. The salt stress-induced
 
increase in the OsMYB2 transcript peaked after 5 h of salt
 
stress, and thereafter the transcript declined gradually under
 
salt stress . A similar increase in the OsMYB2
 
transcript was also observed when rice seedlings were
 
exposed to low temperature (2℃) or osmotic stress (20%
 
PEG) . In addition, treatment of rice seedlings with ABA
 
also led to an increase in expression of OsMYB2. In contrast,
 
exogenous application of salicylic acid reduced the expression of OsMYB2, while no effect of
 
indoleacetic acid and brassinosteroids on the OsMYB2
 
transcript was observed. OsMYB2 was detected in roots,
 
shoots, leaves, and flowers under non-stressed conditions,
 
with the expression being greatest in leaves, followed by
 
roots and shoots . The strong induction of this
 
gene by abiotic stress prompted this study to check its
 
promoter sequence (1500 bp upstream from the transcription
 
start site) by searching the promoter sequence against
 
the PLACE database [(http://www.dna.affrc.go.jp/PLACE/)].
 
The promoter of OsMYB2 contains stress-responsive related
 
cis-elements, such as ABRE and MYB and MYC
 
recognition sites
 
 
 
[[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg]]
 
  
 
===Evolution===
 
===Evolution===
Phylogenetic tree of MYB proteins(figure 6).
+
* OsMYB2 representative by '''''LOC_Os3g20090''''' ('''''Os03g0315400''''') is belong to C12, and of which are involved in stress response.
 
 
 
 
[[File:Phylogenetic tree of MYB proteins.jpg]]
 
 
 
OsMYB2 representative by LOC_Os3g20090 is belong to C12, and of which are involved in stress response.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
1 State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093,
+
* State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China
PR China
+
* Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China
  
2 Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China
+
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Yang A, Dai X, Zhang WH. A R2R3-type MYB gene, OsMYB2, is involved in salt,
 +
cold, and dehydration tolerance in rice. J Exp Bot. 2012 Apr;63(7):2541-56. doi:
 +
10.1093/jxb/err431. PubMed PMID: 22301384; PubMed Central PMCID: PMC3346221.
 +
</ref>
  
==References==
+
</references>
A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.An Yang1,2, Xiaoyan Dai1 and Wen-Hao Zhang*,1.Journal of Experimental Botany, Vol. 63, No. 7, pp. 2541–2556, 2012.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0315400|
 
Description = Similar to Typical P-type R2R3 Myb protein (Fragment)|
 
Version = NM_001056472.1 GI:115452672 GeneID:4332651|
 
Length = 2127 bp|
 
Definition = Oryza sativa Japonica Group Os03g0315400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:11376759..11378885|
 
CDS = 11377201..11378033,11378520..11378676|
 
GCID = <gbrowseImage1>
 
name=NC_008396:11376759..11378885
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:11376759..11378885
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtga</cdnaseq>|
 
AA = <aaseq>MDMAHERDASSEEEVMGGDLRRGPWTVEEDLLLVNYIAAHGEGR                    WNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQ                    HLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAAGQQ                    QQQEGGTDTPPLSWQHGGSDGLYESPELPAPDASCWPAEYCAAAGGAQSGGTPAPELS                    STTAGSSSLSTDSGAGAQPSWPTQADGAEWFTTACDASSATGGVAMRDTELELAQPPC                    QGGQTWTTSESSLPGLTFPDLAVADFEIGGFDVDSFWTSMEDDQLWCPTQAAV</aaseq>|
 
DNA = <dnaseqindica>853..1685#210..366#agtttcatcgcagcacacatccatccatccatccatctatccagagagcacagcaacggcgcatatatagtacccctctaccaaagcacaacaaccagaatctcctgagctcgatctagctactagcttgatctatccgatcaatcgactggcccgcgaggatcgatcgagactcgaaagggagggattttgatccggatcggtcgacgatggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcaggtaggatcgcgatctcgatcgatcgagctcccaattccaccataaattacatgcacgcacacatcgatcaattccatgagctgagtgtccgtacatgcttagcctgatgagcaattataggacgcaaagtaccagtcgctcttgcatctacatgctgatttctggaaacacagatagctacgagtctaccctgagttctctagcagccaaccagctaagctagaagctatagtgagtgagagggaaaggggagagaatttttagtggttagcagcgtagctagcattgttcatagggatatttttagttgctcatccctcccccgttacatcatccatcctgccgtcgtcgtatgcgtataactgcattagtatataattgattagttgctgcatactatgttttagcaatggtgtactacatgtgaatattttgatgtgacgtgaagagaaaaattaatcttggtttttggttgttgtcatgcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtgaaaagtcagcacggccgccatgggaatccgccgcggcgagcgagcgcgcgcgcgcgcgacacccgcgggtgcacaaccgccggggacgcgtagcggagcggagaagcggattagaagaaggagagaagctatctgggggattagaacaagattaatcgcctcacgatgccatttttggactcctagctcccagactattctaactccagttcttttccgtttctttctccttttttacttcctagggtaaaaaaaaagaagttaaagtgtagccgttatactagtgttgatgctgctgttactaaagtttgtccgttaaattttactcattctttttgagtaaatacagtactgccactactgtatgtacgagctgaactctgtaggattgacaggattactgtacacttctagaaaccggtaataaaagcaaagctccgacg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056472.1 RefSeq:Os03g0315400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 01:53, 14 February 2017

The rice Os03g0315400 was reported as OsMYB2 in 2012 [1] by researchers from China.

Annotated Information

Figure 2. Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.[1].

Gene Symbol

  • Os03g0315400 <=> OsMYB2,MYB2

Function

  • OsMYB2 encodes a stress-responsive MYB transcription factor.
  • OsMYB2 plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress.

Phenotypic analysis

  • No difference in growth and development between the OsMYB2-overexpressing and wild-type plants was observed under normal growth conditions, but the OsMYB2-overexpressing plants were more tolerant to salt, cold, and dehydration stresses and more sensitive to abscisic acid than wild-type plants.
  • The OsMYB2-overexpressing plants accumulated greater amounts of soluble sugars and proline than wild-type plants under salt stress. Overexpression of OsMYB2 enhanced up-regulation of genes encoding proline synthase and transporters. The OsMYB2-overexpressing plants accumulated less amounts of H2O2 and malondialdehyde.
  • The enhanced activities of antioxidant enzymes, including peroxidase, superoxide dismutase, and catalase, may underlie the lower H2O2 contents in OsMYB2-overexpressing plants.
  • There was greater up-regulation of stress-related genes, including OsLEA3, OsRab16A, and OsDREB2A, in the OsMYB2-overexpressing plants. Microarray analysis showed that expression of numerous genes involving diverse functions in stress response was altered in the OsMYB2-overexpressing plants.

Expression

  • Expression of OsMYB2 was up-regulated by salt, cold, and dehydration stress.

Subcellular localization

  • OsMYB2 was localized in the nucleus with transactivation activity.
Figure 1. Subcellular localization and transactivation analysis of OsMYB2.[1].

Evolution

  • OsMYB2 representative by LOC_Os3g20090 (Os03g0315400) is belong to C12, and of which are involved in stress response.

Labs working on this gene

  • State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China
  • Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China

References

  1. 1.0 1.1 1.2 Yang A, Dai X, Zhang WH. A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J Exp Bot. 2012 Apr;63(7):2541-56. doi: 10.1093/jxb/err431. PubMed PMID: 22301384; PubMed Central PMCID: PMC3346221.

Structured Information