|
|
| (14 intermediate revisions by 5 users not shown) |
| Line 1: |
Line 1: |
| − | Its gene name ''OsMYB2'', is a R2R3-type MYB gene, expression a MYB-type transcription factor plays a important role in the tolerance to abiotic stress of plants.
| + | The rice '''''Os03g0315400''''' was reported as '''''OsMYB2''''' in 2012 <ref name="ref1" /> by researchers from China. |
| | + | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg|right|thumb|327px|'''Figure 2.''' ''Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.<ref name="ref1" />.'']] |
| | + | |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0315400''''' '''<=>''' '''''OsMYB2,MYB2''''' |
| | ===Function=== | | ===Function=== |
| − | 1、Overexpression of ''OsMYB2'' enhanced tolerance to salt cold, and dehydration stress（figure 1）.
| + | * '''''OsMYB2''''' encodes a stress-responsive MYB transcription factor. |
| − | | + | * '''''OsMYB2''''' plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress. |
| − | [[File:The tolerance to abiotic of overexpression and RNAi of OsMYB2.jpg]]
| + | ===Phenotypic analysis=== |
| − | | + | * No difference in growth and development between the OsMYB2-overexpressing and wild-type plants was observed under normal growth conditions, but the OsMYB2-overexpressing plants were more tolerant to salt, cold, and dehydration stresses and more sensitive to abscisic acid than wild-type plants. |
| − | The involvement of OsMYB2 in salt, cold, and osmotic
| + | * The OsMYB2-overexpressing plants accumulated greater amounts of soluble sugars and proline than wild-type plants under salt stress. Overexpression of OsMYB2 enhanced up-regulation of genes encoding proline synthase and transporters. The OsMYB2-overexpressing plants accumulated less amounts of H2O2 and malondialdehyde. |
| − | stress was investigated by exposing wild-type and the
| + | * The enhanced activities of antioxidant enzymes, including peroxidase, superoxide dismutase, and catalase, may underlie the lower H2O2 contents in OsMYB2-overexpressing plants. |
| − | transgenic plants grown in hydroponic solution with NaCl,
| + | * There was greater up-regulation of stress-related genes, including OsLEA3, OsRab16A, and OsDREB2A, in the OsMYB2-overexpressing plants. Microarray analysis showed that expression of numerous genes involving diverse functions in stress response was altered in the OsMYB2-overexpressing plants. |
| − | low temperature, and PEG. There was no difference
| |
| − | between transgenic and wild-type plants when grown under | |
| − | normal, non-stressed conditions in hydroponic solution | |
| − | (A). Phenotypically, most OsMYB2-overexpressing
| |
| − | seedlings remained green and showed continuous growth,
| |
| − | whereas both wild-type and RNAi seedlings showed severe
| |
| − | leaf rolling and wilting after exposure to the salt, cold, and
| |
| − | osmotic stress (B-D).In addition, the two transgenic
| |
| − | rice lines overexpressing OsMYB2 grown in soil also
| |
| − | exhibited greater tolerance to NaCl, cold, and drought
| |
| − | stress than wild-type and RNAi plants（data not shown）
| |
| − |
| |
| − | WT:wildtype;
| |
| − | OE2 and OE3: ''OsMYB2'' overexpression strain;
| |
| − | Ri1 and Ri3: ''OsMYB2'' RNAi strain;
| |
| − | | |
| − | 2、Overexpression of ''OsMYB2'' altered sensitivity of seed germination and growth to salt stress and ABA(figure 2).
| |
| − | | |
| − | [[File:Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg]]
| |
| − | | |
| − | 3、''OsMYB2''-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).
| |
| − | | |
| − | [[File:Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg]]
| |
| − | | |
| − | 4、''OsMYB2''-overexpression plants accumulated less H2O2 and MDA under salt stress(figure 4).
| |
| − | | |
| − | [[File:Effect of salt stress on contents of oxidants (A and B) and antioxidant enzymes (C–D) in wild-type and transgenic rice plants.jpg]]
| |
| − | | |
| − | 5、''OsMYB2''-overexpression plants affect some genes' expression profiles. Some genes upregulation can contribute to enhanced tolerance of plants to salt stress and some may involved in stress response.
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | ''OsMYB2'' was detected in roots,shoots,leaves, and flowers, but it was specifically located in the nucleus(figure 5) | + | * Expression of '''''OsMYB2''''' was up-regulated by salt, cold, and dehydration stress. |
| | | | |
| − | [[File:Subcellular localization of OsMYB2.jpg]]
| + | ===Subcellular localization=== |
| − | | + | * OsMYB2 was localized in the nucleus with transactivation activity. |
| − | a、b、c: localization of GFP ; e、d、f:localization of GFP-OsMYB2
| + | [[File:Subcellular localization of OsMYB2.jpg|center|thumb|727px|'''Figure 1.''' ''Subcellular localization and transactivation analysis of OsMYB2.<ref name="ref1" />.'']] |
| − | | |
| − | The response of OsMYB2 expression to salt, cold, and
| |
| − | dehydration stress was monitored by real-time RT-PCR.
| |
| − | An increase in the OsMYB2 transcript was observed after
| |
| − | 30 min of exposure to salt stress. The salt stress-induced
| |
| − | increase in the OsMYB2 transcript peaked after 5 h of salt
| |
| − | stress, and thereafter the transcript declined gradually under
| |
| − | salt stress . A similar increase in the OsMYB2
| |
| − | transcript was also observed when rice seedlings were
| |
| − | exposed to low temperature (2℃) or osmotic stress (20%
| |
| − | PEG) . In addition, treatment of rice seedlings with ABA
| |
| − | also led to an increase in expression of OsMYB2. In contrast,
| |
| − | exogenous application of salicylic acid reduced the expression of OsMYB2, while no effect of
| |
| − | indoleacetic acid and brassinosteroids on the OsMYB2
| |
| − | transcript was observed. OsMYB2 was detected in roots,
| |
| − | shoots, leaves, and flowers under non-stressed conditions,
| |
| − | with the expression being greatest in leaves, followed by
| |
| − | roots and shoots . The strong induction of this
| |
| − | gene by abiotic stress prompted this study to check its
| |
| − | promoter sequence (1500 bp upstream from the transcription
| |
| − | start site) by searching the promoter sequence against
| |
| − | the PLACE database [(http://www.dna.affrc.go.jp/PLACE/)].
| |
| − | The promoter of OsMYB2 contains stress-responsive related
| |
| − | cis-elements, such as ABRE and MYB and MYC
| |
| − | recognition sites
| |
| − | | |
| − | [[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg]]
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Phylogenetic tree of MYB proteins(figure 6).
| + | * OsMYB2 representative by '''''LOC_Os3g20090''''' ('''''Os03g0315400''''') is belong to C12, and of which are involved in stress response. |
| − | | |
| − | | |
| − | [[File:Phylogenetic tree of MYB proteins.jpg]]
| |
| − | | |
| − | OsMYB2 representative by LOC_Os3g20090 is belong to C12, and of which are involved in stress response. | |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1 State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093,
| + | * State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China |
| − | PR China | + | * Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China |
| | | | |
| − | 2 Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China
| + | ==References== |
| | + | <references> |
| | + | * <ref name="ref1"> |
| | + | Yang A, Dai X, Zhang WH. A R2R3-type MYB gene, OsMYB2, is involved in salt, |
| | + | cold, and dehydration tolerance in rice. J Exp Bot. 2012 Apr;63(7):2541-56. doi: |
| | + | 10.1093/jxb/err431. PubMed PMID: 22301384; PubMed Central PMCID: PMC3346221. |
| | + | </ref> |
| | | | |
| − | ==References==
| + | </references> |
| − | A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.An Yang1,2, Xiaoyan Dai1 and Wen-Hao Zhang*,1.Journal of Experimental Botany, Vol. 63, No. 7, pp. 2541–2556, 2012.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0315400|
| |
| − | Description = Similar to Typical P-type R2R3 Myb protein (Fragment)|
| |
| − | Version = NM_001056472.1 GI:115452672 GeneID:4332651|
| |
| − | Length = 2127 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0315400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:11376759..11378885|
| |
| − | CDS = 11377201..11378033,11378520..11378676|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:11376759..11378885
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:11376759..11378885
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtga</cdnaseq>|
| |
| − | AA = <aaseq>MDMAHERDASSEEEVMGGDLRRGPWTVEEDLLLVNYIAAHGEGR WNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQ HLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAAGQQ QQQEGGTDTPPLSWQHGGSDGLYESPELPAPDASCWPAEYCAAAGGAQSGGTPAPELS STTAGSSSLSTDSGAGAQPSWPTQADGAEWFTTACDASSATGGVAMRDTELELAQPPC QGGQTWTTSESSLPGLTFPDLAVADFEIGGFDVDSFWTSMEDDQLWCPTQAAV</aaseq>|
| |
| − | DNA = <dnaseqindica>853..1685#210..366#agtttcatcgcagcacacatccatccatccatccatctatccagagagcacagcaacggcgcatatatagtacccctctaccaaagcacaacaaccagaatctcctgagctcgatctagctactagcttgatctatccgatcaatcgactggcccgcgaggatcgatcgagactcgaaagggagggattttgatccggatcggtcgacgatggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcaggtaggatcgcgatctcgatcgatcgagctcccaattccaccataaattacatgcacgcacacatcgatcaattccatgagctgagtgtccgtacatgcttagcctgatgagcaattataggacgcaaagtaccagtcgctcttgcatctacatgctgatttctggaaacacagatagctacgagtctaccctgagttctctagcagccaaccagctaagctagaagctatagtgagtgagagggaaaggggagagaatttttagtggttagcagcgtagctagcattgttcatagggatatttttagttgctcatccctcccccgttacatcatccatcctgccgtcgtcgtatgcgtataactgcattagtatataattgattagttgctgcatactatgttttagcaatggtgtactacatgtgaatattttgatgtgacgtgaagagaaaaattaatcttggtttttggttgttgtcatgcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtgaaaagtcagcacggccgccatgggaatccgccgcggcgagcgagcgcgcgcgcgcgcgacacccgcgggtgcacaaccgccggggacgcgtagcggagcggagaagcggattagaagaaggagagaagctatctgggggattagaacaagattaatcgcctcacgatgccatttttggactcctagctcccagactattctaactccagttcttttccgtttctttctccttttttacttcctagggtaaaaaaaaagaagttaaagtgtagccgttatactagtgttgatgctgctgttactaaagtttgtccgttaaattttactcattctttttgagtaaatacagtactgccactactgtatgtacgagctgaactctgtaggattgacaggattactgtacacttctagaaaccggtaataaaagcaaagctccgacg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056472.1 RefSeq:Os03g0315400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
_PCR_analysis_for_the_expression_of_OsMYB2_in_rice.jpg){kind=spacer}
