|
|
| (9 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Its gene name ''OsMYB2'', is a R2R3-type MYB gene, expression a MYB-type transcription factor plays a important role in the tolerance to abiotic stress of plants.
| + | The rice '''''Os03g0315400''''' was reported as '''''OsMYB2''''' in 2012 <ref name="ref1" /> by researchers from China. |
| | + | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg|right|thumb|327px|'''Figure 2.''' ''Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.<ref name="ref1" />.'']] |
| | + | |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0315400''''' '''<=>''' '''''OsMYB2,MYB2''''' |
| | ===Function=== | | ===Function=== |
| − | 1、Overexpression of ''OsMYB2'' enhanced tolerance to salt cold, and dehydration stress(figure 1).
| + | * '''''OsMYB2''''' encodes a stress-responsive MYB transcription factor. |
| − | | + | * '''''OsMYB2''''' plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress. |
| − | [[File:The tolerance to abiotic of overexpression and RNAi of OsMYB2.jpg]]
| + | ===Phenotypic analysis=== |
| − | | + | * No difference in growth and development between the OsMYB2-overexpressing and wild-type plants was observed under normal growth conditions, but the OsMYB2-overexpressing plants were more tolerant to salt, cold, and dehydration stresses and more sensitive to abscisic acid than wild-type plants. |
| − | The involvement of OsMYB2 in salt, cold, and osmotic
| + | * The OsMYB2-overexpressing plants accumulated greater amounts of soluble sugars and proline than wild-type plants under salt stress. Overexpression of OsMYB2 enhanced up-regulation of genes encoding proline synthase and transporters. The OsMYB2-overexpressing plants accumulated less amounts of H2O2 and malondialdehyde. |
| − | stress was investigated by exposing wild-type and the | + | * The enhanced activities of antioxidant enzymes, including peroxidase, superoxide dismutase, and catalase, may underlie the lower H2O2 contents in OsMYB2-overexpressing plants. |
| − | transgenic plants grown in hydroponic solution with NaCl,
| + | * There was greater up-regulation of stress-related genes, including OsLEA3, OsRab16A, and OsDREB2A, in the OsMYB2-overexpressing plants. Microarray analysis showed that expression of numerous genes involving diverse functions in stress response was altered in the OsMYB2-overexpressing plants. |
| − | low temperature, and PEG. There was no difference
| |
| − | between transgenic and wild-type plants when grown under
| |
| − | normal, non-stressed conditions in hydroponic solution
| |
| − | (A). Phenotypically, most OsMYB2-overexpressing
| |
| − | seedlings remained green and showed continuous growth,
| |
| − | whereas both wild-type and RNAi seedlings showed severe
| |
| − | leaf rolling and wilting after exposure to the salt, cold, and
| |
| − | osmotic stress (B-D).In addition, the two transgenic
| |
| − | rice lines overexpressing OsMYB2 grown in soil also
| |
| − | exhibited greater tolerance to NaCl, cold, and drought
| |
| − | stress than wild-type and RNAi plants(data not shown)
| |
| − |
| |
| − | WT:wildtype;
| |
| − | OE2 and OE3: ''OsMYB2'' overexpression strain;
| |
| − | Ri1 and Ri3: ''OsMYB2'' RNAi strain;
| |
| − | | |
| − | 2、Overexpression of ''OsMYB2'' altered sensitivity of seed germination and growth to salt stress and ABA(figure 2).
| |
| − | | |
| − | [[File:Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg]]
| |
| − | | |
| − | This study also determined the survival rate for wild-type and
| |
| − | transgenic plants grown in both hydroponic solution and
| |
| − | soil challenged with salt, cold, and osmotic stress.the survival rate of overexpressing lines was
| |
| − | significantly higher than that of wild-type and RNAi
| |
| − | seedlings when exposed to salt stress (200 mM NaCl for
| |
| − | 2 d), cold stress (5 ℃ for 3 d), and osmotic stress (20%
| |
| − | PEG6000 for 2 d). The survival rates of the two overexpressing
| |
| − | lines higher than those of wild-type and RNAi
| |
| − | plants were also observed when rice seedlings grown in | |
| − | soil were challenged by salt, cold, and drought stress(D-F)
| |
| − | | |
| − | 3、''OsMYB2''-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).
| |
| − | | |
| − | [[File:Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg]]
| |
| − | | |
| − | Exposure of
| |
| − | both wild-type and transgenic seeds to NaCl reduced their
| |
| − | germination rate (A). However, germination of
| |
| − | OsMYB2-overexpressing seeds was less inhibited by NaCl | |
| − | than that of wild-type and RNAi seeds. For example, seed
| |
| − | germination rate of the two OsMYB2-overexpressing lines
| |
| − | (OE2, OE3) was 81% and 86% when incubated in the
| |
| − | presence of 100 mM NaCl, while germination rate for wildtype
| |
| − | and RNAi (Ri1, Ri3) seeds was found to be 51%, 49%,
| |
| − | and 53% under the identical conditions, respectively. The | |
| − | effect of NaCl on seedling growth was also examined. In
| |
| − | the saline medium containing 150 mM NaCl, the OsMYB2-
| |
| − | overexpressing plants exhibited faster growth and their | |
| − | shoots were significantly longer than wild-type plants
| |
| − | (Fig. 6B, C).
| |
| − | In contrast to salt stress, seed germination of OsMYB2-
| |
| − | overexpressing lines was more sensitive to ABA than
| |
| − | that of wild-type and RNAi lines, such that wild-type
| |
| − | and RNAi lines had higher seed germination rate than
| |
| − | Fig. 3. Molecular characterization and phenotypes of OsMYB2
| |
| − | transgenic rice. (A) OsMYB2 expression in wild-type and transgenic
| |
| − | rice. Total RNAs from 14-d-old wild-type and transgenic rice
| |
| − | plants were isolated, reverse-transcribed, and analysed by realtime
| |
| − | reverse-transcription PCR. Actin was used as an internal
| |
| − | control. Error bars are based on three replicates. (B) The
| |
| − | phenotypes of the T3 generation of wild-type and transgenic
| |
| − | plants after growing on 1/2 MS medium for 14 days. (C) The
| |
| − | phenotypes of the T3 generation of wild-type and transgenic
| |
| − | plants after growing in soil for 30 days. Data are mean6SE of
| |
| − | three biological replicates. Asterisks indicate statistically significant
| |
| − | differences (P < 0.05) between wild-type (WT) and transgenic lines
| |
| − | (OE and Ri).
| |
| − | 2546 | Yang et al.
| |
| − | Downloaded from http://jxb.oxfordjournals.org/ at Institute of Biophysics,CAS on May 28, 2014
| |
| − | OsMYB2-overexpressing lines when ABA was present in the
| |
| − | incubation medium (D). Like seed germination, growth
| |
| − | of OsMYB2-overexpressing seedlings was more inhibited by
| |
| − | ABA than that of wild-type and RNAi seedlings, as shown by
| |
| − | a shorter length of OsMYB2-overexpressing seedlings than
| |
| − | wild-type and RNAi seedlings when grown in the presence of
| |
| − | ABA (E, F). No difference in shoot length of wild-type
| |
| − | and the transgenic plants grown in control medium was found.
| |
| − | | |
| − | 4、''OsMYB2''-overexpression plants accumulated less H2O2 and MDA under salt stress(figure 4).
| |
| − | | |
| − | [[File:Effect of salt stress on contents of oxidants (A and B) and antioxidant enzymes (C–D) in wild-type and transgenic rice plants.jpg]]
| |
| − | | |
| − | 5、''OsMYB2''-overexpression plants affect some genes' expression profiles. Some genes upregulation can contribute to enhanced tolerance of plants to salt stress and some may involved in stress response.
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | ''OsMYB2'' was detected in roots,shoots,leaves, and flowers, but it was specifically located in the nucleus(figure 5) | + | * Expression of '''''OsMYB2''''' was up-regulated by salt, cold, and dehydration stress. |
| − | | |
| − | [[File:Subcellular localization of OsMYB2.jpg]]
| |
| − | | |
| − | a、b、c: localization of GFP ; e、d、f:localization of GFP-OsMYB2
| |
| − | | |
| − | The response of OsMYB2 expression to salt, cold, and
| |
| − | dehydration stress was monitored by real-time RT-PCR. | |
| − | An increase in the OsMYB2 transcript was observed after
| |
| − | 30 min of exposure to salt stress. The salt stress-induced
| |
| − | increase in the OsMYB2 transcript peaked after 5 h of salt
| |
| − | stress, and thereafter the transcript declined gradually under
| |
| − | salt stress . A similar increase in the OsMYB2
| |
| − | transcript was also observed when rice seedlings were
| |
| − | exposed to low temperature (2℃) or osmotic stress (20%
| |
| − | PEG) . In addition, treatment of rice seedlings with ABA
| |
| − | also led to an increase in expression of OsMYB2. In contrast,
| |
| − | exogenous application of salicylic acid reduced the expression of OsMYB2, while no effect of
| |
| − | indoleacetic acid and brassinosteroids on the OsMYB2
| |
| − | transcript was observed. OsMYB2 was detected in roots,
| |
| − | shoots, leaves, and flowers under non-stressed conditions,
| |
| − | with the expression being greatest in leaves, followed by
| |
| − | roots and shoots . The strong induction of this
| |
| − | gene by abiotic stress prompted this study to check its
| |
| − | promoter sequence (1500 bp upstream from the transcription
| |
| − | start site) by searching the promoter sequence against
| |
| − | the PLACE database [(http://www.dna.affrc.go.jp/PLACE/)].
| |
| − | The promoter of OsMYB2 contains stress-responsive related
| |
| − | cis-elements, such as ABRE and MYB and MYC
| |
| − | recognition sites
| |
| − | | |
| − | [[File:Real-time reverse-transcription (RT) PCR analysis for the expression of OsMYB2 in rice.jpg]]
| |
| | | | |
| − | The effects of NaCl on H2O2 and MDA contents in wild-type
| + | ===Subcellular localization=== |
| − | and transgenic rice were investigated and no significant differences
| + | * OsMYB2 was localized in the nucleus with transactivation activity. |
| − | in H2O2 and MDA contents were found in the absence
| + | [[File:Subcellular localization of OsMYB2.jpg|center|thumb|727px|'''Figure 1.''' ''Subcellular localization and transactivation analysis of OsMYB2.<ref name="ref1" />.'']] |
| − | of NaCl in the incubation medium (Fig.8A, B). There were
| |
| − | marked increases in H2O2 and MDA contents in both wildtype
| |
| − | and transgenic plants upon exposure to 200 mM NaCl.
| |
| − | However, the salt stress-induced increases in H2O2 and MDA
| |
| − | contents were less in the OsMYB2-overexpressing plants than
| |
| − | those in the wild-type and RNAi plants. These results indicate
| |
| − | that overexpression of OsMYB2 confers greater tolerance of
| |
| − | the oxidative stress associated with salt stress.
| |
| − | The lower content of H2O2 in the OsMYB2-overexpressing
| |
| − | plants under salt stress prompted this study to test whether
| |
| − | the difference in H2O2 accumulation between wild-type and
| |
| − | the OsMYB2-overexpressing lines resulted from differences
| |
| − | in the activities of the major antioxidant enzymes. Under
| |
| − | normal conditions, activities of POD, SOD, and CAT were
| |
| − | Fig. 5. Effect of salt, cold, and dehydration stress on survival rates of wild-type and transgenic rice plants, corresponding to the plants and
| |
| − | treatments as shown in Fig. 4. (A–C) Plants grown on 1/2 medium. (D–F) Plants grown in soil. Data are mean6SE of three replicates with total
| |
| − | seedling number of 80 for all stress treatments. Values in parentheses are the numbers of survived seedlings/total seedlings used to calculate
| |
| − | the survival rate. Asterisks indicate statistically significant differences (P < 0.05) between wild-type (WT) and transgenic lines (OE and Ri).
| |
| − | 2548 | Yang et al.
| |
| − | Downloaded from http://jxb.oxfordjournals.org/ at Institute of Biophysics,CAS on May 28, 2014
| |
| − | comparable among wild-type, OsMYB2-overexpressing,
| |
| − | and RNAi plants (C-E). There were marked increases
| |
| − | in activities of these enzymes for the rice seedlings upon
| |
| − | exposure to salt stress. However, the salt stress-induced
| |
| − | increases in activities of POD, SOD, and CAT were higher
| |
| − | in the OsMYB2-overexpressing plants than the wild-type
| |
| − | and RNAi plants (C-E). In contrast to OsMYB2-
| |
| − | overexpressing plants, activities of these enzymes in the
| |
| − | OsMYB2-RNAi lines did not differ from the wild-type
| |
| − | plants under salt-stressed conditions (Fig.8C-E). These
| |
| − | results imply that overexpression of OsMYB2 confers
| |
| − | a more efficient antioxidant system to counteract oxidative
| |
| − | stress under saline conditions.
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Phylogenetic tree of MYB proteins(figure 6).
| + | * OsMYB2 representative by '''''LOC_Os3g20090''''' ('''''Os03g0315400''''') is belong to C12, and of which are involved in stress response. |
| − | | |
| − | | |
| − | [[File:Phylogenetic tree of MYB proteins.jpg]]
| |
| − | | |
| − | OsMYB2 representative by LOC_Os3g20090 is belong to C12, and of which are involved in stress response. | |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1 State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093,
| + | * State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China |
| − | PR China | + | * Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China |
| | | | |
| − | 2 Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China
| + | ==References== |
| | + | <references> |
| | + | * <ref name="ref1"> |
| | + | Yang A, Dai X, Zhang WH. A R2R3-type MYB gene, OsMYB2, is involved in salt, |
| | + | cold, and dehydration tolerance in rice. J Exp Bot. 2012 Apr;63(7):2541-56. doi: |
| | + | 10.1093/jxb/err431. PubMed PMID: 22301384; PubMed Central PMCID: PMC3346221. |
| | + | </ref> |
| | | | |
| − | ==References==
| + | </references> |
| − | A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.An Yang1,2, Xiaoyan Dai1 and Wen-Hao Zhang*,1.Journal of Experimental Botany, Vol. 63, No. 7, pp. 2541–2556, 2012.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0315400|
| |
| − | Description = Similar to Typical P-type R2R3 Myb protein (Fragment)|
| |
| − | Version = NM_001056472.1 GI:115452672 GeneID:4332651|
| |
| − | Length = 2127 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0315400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:11376759..11378885|
| |
| − | CDS = 11377201..11378033,11378520..11378676|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:11376759..11378885
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:11376759..11378885
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtga</cdnaseq>|
| |
| − | AA = <aaseq>MDMAHERDASSEEEVMGGDLRRGPWTVEEDLLLVNYIAAHGEGR WNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQ HLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAAGQQ QQQEGGTDTPPLSWQHGGSDGLYESPELPAPDASCWPAEYCAAAGGAQSGGTPAPELS STTAGSSSLSTDSGAGAQPSWPTQADGAEWFTTACDASSATGGVAMRDTELELAQPPC QGGQTWTTSESSLPGLTFPDLAVADFEIGGFDVDSFWTSMEDDQLWCPTQAAV</aaseq>|
| |
| − | DNA = <dnaseqindica>853..1685#210..366#agtttcatcgcagcacacatccatccatccatccatctatccagagagcacagcaacggcgcatatatagtacccctctaccaaagcacaacaaccagaatctcctgagctcgatctagctactagcttgatctatccgatcaatcgactggcccgcgaggatcgatcgagactcgaaagggagggattttgatccggatcggtcgacgatggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcaggtaggatcgcgatctcgatcgatcgagctcccaattccaccataaattacatgcacgcacacatcgatcaattccatgagctgagtgtccgtacatgcttagcctgatgagcaattataggacgcaaagtaccagtcgctcttgcatctacatgctgatttctggaaacacagatagctacgagtctaccctgagttctctagcagccaaccagctaagctagaagctatagtgagtgagagggaaaggggagagaatttttagtggttagcagcgtagctagcattgttcatagggatatttttagttgctcatccctcccccgttacatcatccatcctgccgtcgtcgtatgcgtataactgcattagtatataattgattagttgctgcatactatgttttagcaatggtgtactacatgtgaatattttgatgtgacgtgaagagaaaaattaatcttggtttttggttgttgtcatgcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtgaaaagtcagcacggccgccatgggaatccgccgcggcgagcgagcgcgcgcgcgcgcgacacccgcgggtgcacaaccgccggggacgcgtagcggagcggagaagcggattagaagaaggagagaagctatctgggggattagaacaagattaatcgcctcacgatgccatttttggactcctagctcccagactattctaactccagttcttttccgtttctttctccttttttacttcctagggtaaaaaaaaagaagttaaagtgtagccgttatactagtgttgatgctgctgttactaaagtttgtccgttaaattttactcattctttttgagtaaatacagtactgccactactgtatgtacgagctgaactctgtaggattgacaggattactgtacacttctagaaaccggtaataaaagcaaagctccgacg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056472.1 RefSeq:Os03g0315400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |