|
|
| (37 intermediate revisions by 5 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os03g0123300''''' was reported as '''''TE''''' in 2012 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0123300''''' '''''<=>''''' '''''TE''''','''''TAD1''''','''''OsCCS52A''''','''''OsWD40-61''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | ''Tillering and Dwarf 1''(''TAD1''), which encodes a co-activator of the anaphase-promoting complex (APC/C), a multi-subunit E3 ligase. The protein interacts with moC1, forms a complex with osAPC10 and functions as a co-activator of APC/C to target MoC1 for degradation in a cell-cycle-dependent manner. | + | * '''''TE''''' encodes a rice homologue of Cdh1, and that TE acts as an activator of the anaphase promoting complex/cyclosome (APC/C) complex |
| | + | * Besides having a conserved role in regulating cell cycle, APC/C TE has a unique function in regulating the plant-specific postembryonic shoot branching and tillering, which are major determinants of plant architecture and grain yield. |
| | | | |
| − | ''TAD1'' encodes a Cdh1-type activator of APC/C, an ortholog to CCS52A in dicots.During the cell-cycl progression, ''TAD1'' shows an oscillating expression pattern with a higher level in the G1-phase.The ''TAD1''-deduced amino-acid sequence contains several conserved domains, including seven WD repeats, C-box, CSM, RVL and IR motifs.
| + | ===Phenotypic analysis=== |
| − | | + | * The rice tiller enhancer (te) mutant displays a drastically increased tiller number. |
| − | Deternination of the interaction between TAD1 and MOC1 by coimmunoprecipitation and BiFC assays.
| + | <br> |
| − | [[File:Deternination_of_the_interaction_between_TAD1_and_MOC1_by_coimmunoprecipitation_and_BiFC_assays.png]]
| + | [[File:214-Os03g0123300.png|center|thumb|827px|'''Figure 1.''' ''Phenotype characterization of te mutant and map-based cloning of TE.(a) Phenotype of WT and te plants at the seventh leaf stage. (b) Phenotype of WT and te plants at the heading stage. (c) WT produces un-elongated lateral bud (left panel, arrowhead) on the elongated upper internodes, whereas te mutant produces additional tillers (right panel, arrowhead) from the elongated internodes. (d) Tiller number comparison between WT (blue) and te (red) plants at the heading stage. TTs, total tillers; LTs, lower node tillers; HTs, higher node tillers. LTs are the tillers outgrown from the un-elongated basal internodes. HTs are the tillers outgrown from the elongated internodes.<ref name="ref1" />.'']] |
| − | | |
| − | Sequence analysis revealed that MOC1 harbours a typical D-box at the N-terminal (Fig. 4a). Therefore, it is very likely that MOC1 and TAD1 directly interact to control rice tillering. MOC1–GFP fusion protein could capture the TAD1–FLAG fusion protein, suggesting an in vivo interaction between MOC1 and TAD1 (Fig. 4b). Bimolecular fluorescence complementation shown in Fig. 4c, when the full-length cDNAs of TAD1 and MOC1 were introduced into rice protoplasts simultaneously, the fluorescence signal was detected in the nucleus, indicating that TAD1 can directly interact with MOC1 in the nucleus. Furthermore, when two conserved residues, arginine and leucine, of the D-box at the N-terminal were changed into alanine (Fig. 4a), the MOC1 protein was unable to interact with TAD1, demonstrating that the D-box is indispensable for the interaction between MOC1 and TAD1 (Fig. 4c). In addition, a series of truncated TAD1 proteins were generated to determine the domains that are essential for the interaction with MOC1 viathe BiFC analysis (Fig. 4d). The results showed that the N-terminal 203 amino acids of TAD1 are sufficient to interact with MOC1.
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Expression of TAD1 during the cell-cycle progression and phenotypes of ''TAD1''-overexpressing transgenic plants.
| + | * TE coexpresses with MOC1 in the axil of leaves, where the APC/C TE complex mediates the degradation of MOC1 by the ubiquitin–26S proteasome pathway, and consequently downregulates the expression of the meristem identity gene Oryza sativa homeobox 1, thus repressing axillary meristem initiation and formation. |
| − | [[File:Expression_of_TAD1_during_the_cell-cycle_progression_and_phenotypes_of_TAD1-overexpressing_transgenic_plants.png]]
| |
| − | | |
| − | | |
| − | ''TAD1'' has an oscillated expression pattern during the cell-cycle progression, showing a higher level in the G1-phase and a lower level in the S- and G2/M-phases. The overexpression of MOC1 resulted in similar phenotypes to that of the tad1mutant plant, such as more tillers and reduced plant height, whereas TAD1-overexpressing transgenic plants showed a reduced tiller number,a similar phenotype to ''moc1''.
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | + | ==References== |
| | + | <references> |
| | + | * <ref name="ref1"> |
| | + | Lin Q, Wang D, Dong H, Gu S, Cheng Z, Gong J, Qin R, Jiang L, Li G, Wang JL, |
| | + | Wu F, Guo X, Zhang X, Lei C, Wang H, Wan J. Rice APC/C(TE) controls tillering by |
| | + | mediating the degradation of MONOCULM 1. Nat Commun. 2012 Mar 20;3:752. doi: |
| | + | 10.1038/ncomms1716. PubMed PMID: 22434195; PubMed Central PMCID: PMC3316886. |
| | + | </ref> |
| | + | </references> |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China. |
| − | | + | * National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China. |
| − | ==References==
| + | * Department of Molecular, Cellular, and Developmental Biology, Yale University, New Haven, Connecticut 06520-8104, USA |
| − | Please input cited references here.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0123300|
| |
| − | Description = Similar to Cell cycle switch protein|
| |
| − | Version = NM_001055339.1 GI:115450406 GeneID:4331448|
| |
| − | Length = 3573 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0123300, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:1305797..1309369|
| |
| − | CDS = 1305822..1306433,1306643..1306765,1306846..1306950,1307352..1307531,1307652..1307714<br>,1307815..1308009,1308368..1308469,1308549..1308611,1308709..1308777<br>,1308879..1308938|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:1305797..1309369
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:1305797..1309369
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactccgcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccgtcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccggcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcgctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctcccccggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgcgccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcctcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcaggttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgagggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctaggtcaccttataaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtggattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaatgcatgcagcagcaaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttcagtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcaggtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagtaggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatccttcaccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggaggtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaacagactttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcatacagcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtggaggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgcgtcgacacaggcagtcaggtctgtaatcttgtatggtcaaagaatgttaatgagcttgttagcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaagctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatggacagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatctcccaagtcccagagttctgacagcctaagtagcatcggggccacatcatttgttaggagctacatccggtga</cdnaseq>|
| |
| − | AA = <aaseq>MDHHHHHLPPPPPRSPMENSASSKPPTPASTPSSRLAAAPSSRV SSAAPHPSPSSSAPTPASRTVYSDRFIPSRAGSNLALFDLAPSPSHHDAAAAAASPGA PPPSGSTPASSPYCALLRAALFGPTTPDRVASSASACSSSSSAGASPVGSPATGNIFR FKAEVPRNAKRALFSDGDDEGVLFPGVFTTRGTGPRKIPRSPYKVLDAPALQDDFYLN LVDWSSHNILAVGLGNCVYLWNACSSKVTKLCDLGVDDNVCSVGWAQRGTHLAVGTNQ GKVQVWDATRCKRIRTMESHRMRVGALAWNSSLLSSGSRDKSILHHDIRAQDDYISRL AGHKSEVCGLKWSYDNRQLASGGNDNRLYVWNQHSAHPVLKYTEHTAAVKAIAWSPHL HGLLASGGGTADRCIRFWNTTTNMHLNCVDTGSQVCNLVWSKNVNELVSTHGYSQNQI IVWRYPTMSKLATLTGHTYRVLYLAISPDGQTIVTGAGDETLRFWNVFPSPKSQSSDS LSSIGATSFVRSYIR</aaseq>|
| |
| − | DNA = <dnaseqindica>26..637#847..969#1050..1154#1556..1735#1856..1918#2019..2213#2572..2673#2753..2815#2913..2981#3083..3142#atccccaaatctctcgcccccacccatggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactccgcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccgtcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccggcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcgctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctcccccggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgcgccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcctcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcaggttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgagggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctaggtcaccttataaggtgagaagtgttcgccttcgatttcatagtttctttcaattgatatggtctgtttcttgattgatgtttctttgaattgagaaaaacatggtctttattattcatctgctctgtaccaagaatcctgtgttatttgtcatgcataaagagactgatatgaaagcttattactcaaaatctcacatgaattttccttctgttgctcttaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtggattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaatgcatgcagcagcaaggtgagccaactgcggccatccatgcgcattcttgtttgggtacttgaagagggtttgtaaagaagtttattgctgtgcaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttcagtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcaggttagacgtatgcccctttctgaaatgatcagataacatagtcatgatccaccaaaatttggaacgatgccttagcttaatctttatctagagtgtcaatggaaacattgagaagtatacaactcacttatggaaagatcagaaaaattgcaatactattaacagtggacctaatttttcgcacaaataatatatgatagacgcagtagagttttatgactaaactgaatgactttcatttttactccaaagaatgaatttggtccattgtaatctctgtttacaaatgtgctgtagtatttgatgattatcgattaatcctgttgagctctgaaattggtatgcaatgctacaatttcaatttggtgtctgactgtcaccttggattttatcttatttaggtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagtaggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatccttcaccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggaggtgatctattttatacatcattatgaattttccgacatgtcagattcttggattatcctattgtgctcccttttgatatattcttataatatgcatattctgtttccaaacacctttcaggtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaacagagtaagaatgcatccatgaattgtttcttgattggatcattggtattacatggaattcaaggttgcaatttcttatgtccatatcaatgtctcttttccagctttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcatacagcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtggaggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgcgtcgacacaggcagtcaggtattttgctacacatctaatttctttagtgattgtgcagcccatgtttatagttctgaactttaatgaactcttgtttattctatttatagtaccatattaaataccgtggtatatggtatgtgaaataagcatgataactctcaatctttggacgcacttaaaaaattgaacatttctttagtcatgtcagttccgaaaagtaagaaatgtaggctgagctctattttcaatagtgaagttctatttcttgttttcatatctgaaaccttcacagaaatgccatgtcattaagactgtagagttaagcatattgttttttggtatgtactgaggacgctgagtgaatcttgaataggtctgtaatcttgtatggtcaaagaatgttaatgagcttgttagcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaaggtatgcttgcaagcttattcttaactcagtacgctttacctttttcttgtattaattgtgctcgatttctcctttgtagctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatggacaggtgaagttatctcttgagtctttgaatctactgaattctgtttattgtatctagaatattttggcatagctgtgtttttgacattttatgtcaacagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatctcccaagtcccaggtaccttttttaaaaatagtataattggtccttatttcaatttgaatgaaatttcactttcatatatagcttctaaataataattggtccttcaattacagagttctgacagcctaagtagcatcggggccacatcatttgttaggagctacatccggtgacactgagatgtggtaatctaataacacttggctcataagtcataacactactgcagcagagtgttgatgatcatcaatatcattccatttgtaccacttgcatcaccagttcatgaaccatcaaacctagccaaattttagagatagtaggatgcagaatggtgaaactggctcgcagacctcggagtggctcatttgctgaatgctgtatatatttattcattggctttgtaggagcgaagatggcaaacactgaccatccgcaatgtaccattgataagttcacggcctcctgtttttgtttttgctgagtcaacttggagctggagctcttatgtataccatgctagggcttaacaacattggccaactcatgatgctcattgcatccaagttggaatatgctaaggaagctggagaatttctggtgc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055339.1 RefSeq:Os03g0123300]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |