Difference between revisions of "Os03g0123300"

From RiceWiki
Jump to: navigation, search
(Function)
(Phenotypic analysis)
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0123300''''' was reported as '''''TE''''' in 2012 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os03g0123300''''' '''''<=>''''' '''''TE''''','''''TAD1''''','''''OsCCS52A''''','''''OsWD40-61'''''
 +
 
===Function===
 
===Function===
'''''Tillering and Dwarf 1'''''('''''TAD1'''''), which encodes a co-activator of the anaphase-promoting complex (APC/C), a multi-subunit E3 ligase. The protein interacts with moC1, forms a complex with osAPC10 and functions as a co-activator of APC/C to target MoC1 for degradation in a cell-cycle-dependent manner.
+
* '''''TE''''' encodes a rice homologue of Cdh1, and that TE acts as an activator of the anaphase promoting complex/cyclosome (APC/C) complex
 
+
* Besides having a conserved role in regulating cell cycle, APC/C TE has a unique function in regulating the plant-specific postembryonic shoot branching and tillering, which are major determinants of plant architecture and grain yield.
''TAD1'' encodes a Cdh1-type activator of  APC/C, an ortholog to CCS52A in dicots.During the cell-cycl progression, ''TAD1'' shows an oscillating expression  pattern with a higher level in the G1-phase.The ''TAD1''-deduced amino-acid sequence contains several conserved domains, including seven WD repeats, C-box, CSM, RVL and IR motifs.Along with APC/C, they form APC/C-TAD1complex and functions as a key regulator of tillering.TAD1 can specifically recruit MOC1 by interacting with OsAPC10 and then degrade MOC1 to maintain an appropriate protein level of MOC1 to control rice tillering. In the absence of TAD1 function, MOC1 fails to be recruited to the APC/C for degradation, resulting in an accumulation of endogenous MOC1 proteins and thus an increase in tiller number in the tad1mutant plant.
 
 
 
                                        [[File:Deternination_of_the_interaction_between_TAD1_and_MOC1_by_coimmunoprecipitation_and_BiFC_assays.png]]
 
                                                  Deternination of the interaction between TAD1 and MOC1 by coimmunoprecipitation and BiFC assays.
 
 
 
Sequence analysis revealed that MOC1 harbours a typical D-box at the N-terminal  (Fig.a). Therefore, it is very likely that MOC1 and TAD1 directly interact to control rice tillering. MOC1–GFP fusion protein could capture the TAD1–FLAG fusion protein, suggesting an in vivo interaction between MOC1 and TAD1 (Fig.b). Bimolecular fluorescence complementation shown in Fig.c, when the full-length cDNAs of ''TAD1'' and ''MOC1'' were introduced into rice protoplasts simultaneously, the fluorescence signal was detected in the nucleus, indicating that TAD1 can directly interact with MOC1 in the nucleus. Furthermore, when  two conserved  residues, arginine  and leucine, of the D-box at the N-terminal were changed  into alanine  (Fig.a),  the ''MOC1'' protein was unable to interact with TAD1, demonstrating that the D-box is indispensable for the interaction between  MOC1 and TAD1 (Fig.c). In addition, a series of truncated ''TAD1'' proteins were generated to determine the domains that are essential for the interaction with MOC1 via the BiFC analysis (Fig.d). The results showed that the N-terminal 203 amino acids of TAD1 are sufficient to interact with MOC1.
 
 
 
                                                [[File:The_APC_C(TAD1)_complex-mediated_degradation_of_MOC1.png]]
 
                                                    The APC C(TAD1) complex-mediated degradation of MOC1.
 
  
OsAPC10 interacts with TAD1 in vivo and their interaction occurs in the nucleus of rice protoplasts. Coexpressed TAD1, MOC1 and OsAPC10 proteins in the rice protoplasts can prove that MOC1 can indeed form a  protein complex with TAD1 and OsAPC10 in vivo(Fig.b). Therefore, it is very likely that TAD1 recruits MOC1 to APC/C, and OsAPC10 is also involved in recognizing and targeting MOC1 for further degradation.
+
===Phenotypic analysis===
TAD1 may recruit MOC1 to APC/C for degradation mainly at the G1-phase Cell division may execute the activation of bud cells. The activity of cell division blocked in the G1-phase possibly accompanies low levels of MOC1 proteins  in  the dormant  tiller  buds. Based on the cellcycle profile of bud cells and the function of APC/C TAD1–MOC1, it can be proposed that the APC/CTAD1–MOC1 complex may act locally in tiller buds. During the cell-cycle progression of tiller bud cells, TAD1 is activated in the G1-phase, where it targets MOC1 for degradation to maintain a low level of MOC1. When tiller cells transit into the next phase, the TAD1 level is reduced, which causes MOC1 to accumulate and regain its function in controlling tillering.
+
* The rice tiller enhancer (te) mutant displays a drastically increased tiller number.
 +
<br>
 +
[[File:214-Os03g0123300.png|center|thumb|827px|'''Figure 1.''' ''Phenotype characterization of te mutant and map-based cloning of TE.(a) Phenotype of WT and te plants at the seventh leaf stage. (b) Phenotype of WT and te plants at the heading stage. (c) WT produces un-elongated lateral bud (left panel, arrowhead) on the elongated upper internodes, whereas te mutant produces additional tillers (right panel, arrowhead) from the elongated internodes. (d) Tiller number comparison between WT (blue) and te (red) plants at the heading stage. TTs, total tillers; LTs, lower node tillers; HTs, higher node tillers. LTs are the tillers outgrown from the un-elongated basal internodes. HTs are the tillers outgrown from the elongated internodes.<ref name="ref1" />.'']]
  
 
===Expression===
 
===Expression===
+
* TE coexpresses with MOC1 in the axil of leaves, where the APC/C TE complex mediates the degradation of MOC1 by the ubiquitin–26S proteasome pathway, and consequently downregulates the expression of the meristem identity gene Oryza sativa homeobox 1, thus repressing axillary meristem initiation and formation.
                                                  [[File:Expression_of_TAD1_during_the_cell-cycle_progression_and_phenotypes_of_TAD1-overexpressing_transgenic_plants.png]]
 
                          Expression of TAD1 during the cell-cycle progression and phenotypes of ''TAD1''-overexpressing transgenic plants.
 
 
 
''TAD1'' has an oscillated expression pattern during the cell-cycle progression, showing a higher level in the G1-phase and a lower level in the S- and G2/M-phases. The  overexpression  of MOC1 resulted in similar phenotypes to that of the tad1mutant plant, such as more tillers and reduced  plant  height, whereas TAD1-overexpressing transgenic plants showed a reduced tiller number,a similar phenotype to ''moc1''.Real-time PCR analysis showed that ''TAD1''is expressed ubiquitously in the examined rice organs, including roots, shoot apices, axillary buds, internodes, nodes, and young leaves  and  panicles, but more abundant in young  leaves, axillary buds and nodes.The tissue-specific expression pattern of ''TAD1'' was further examined by messenger RNA in situhybridization. ''TAD1'' was predominantly expressed in the leaf primordia and young leaves, tiller buds, inflorescence promordia, and crown root promordia. In addition, ''TAD1'' expression was detected in vascular bundles at the unenlongated stem.
 
 
 
===Evolution===
 
In animals, in addition to its essential role involved in cell-cycle progression, the APC/C has also been reported recently to target different substrates in non-mitotic cells such as neurons, muscle cells and  lens  fibre  cells.  In  the ventral  nerve  cord  of ''Caenorhabditis elegans'', the APC/C CDH1 complex regulates synaptic strength by affecting the number of glutamate receptors on the postsynaptic side. In ''Drosophila'', APC/CCdh1 regulates presynaptic organization and synaptic size by targeting liprin-αfor degradation. In mammals, knockdown of ''Cdh1'' leads to increased axon and disrupted axonal patterning. Further studies showed that Cdh1 targets  two key development regulators, inhibitor of DNA binding 2 (Id2) and the transcription corepressor ski-related  novel  protein N (SnoN), for degradation  in  regulating  the  axonal pattern. In  plants,  however, whether  APC/C CDH1 targets the key regulators of plant development other than conserved cell-cycle regulators is still unknown. MOC1 is the first identified target of Cdh1-type  co-activator of APC/C other than cyclins in plants. Loss-of-function of TAD1 disrupts normal plant architecture in rice, which is comparable to the axon phenotypes in mammals.
 
  
 
==References==
 
==References==
Cao Xu;Yonghong Wang;Yanchun Yu;Jingbo Duan;Zhigang Liao;Guosheng Xiong;Xiangbing Meng;Guifu Liu;Qian Qian;Jiayang Li.Degradation of MONOCULM 1 by APC/CTAD1 regulates rice tillering.Nature Communications, 2012, 3: 750
+
<references>
Stegmuller, J. et al.Cell-intrinsic regulation of axonal morphogenesis by the Cdh1-APC target SnoN. Neuron 50,389–400 (2006).
+
* <ref name="ref1">
Lasorella, A. et al.Degradation of Id2 by the anaphase-promoting complex couples cell cycle exit and axonal growth. Nature 442,471–474 (2006).
+
Lin Q, Wang D, Dong H, Gu S, Cheng Z, Gong J, Qin R, Jiang L, Li G, Wang JL,
 
+
Wu F, Guo X, Zhang X, Lei C, Wang H, Wan J. Rice APC/C(TE) controls tillering by  
 +
mediating the degradation of MONOCULM 1. Nat Commun. 2012 Mar 20;3:752. doi:
 +
10.1038/ncomms1716. PubMed PMID: 22434195; PubMed Central PMCID: PMC3316886.
 +
</ref>
 +
</references>
 
==Labs working on this gene==
 
==Labs working on this gene==
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China. State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China. College of Life and Environmental Sciences, Hangzhou Normal University, Hangzhou 310036, China.
+
* National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China.  
 +
* National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China.  
 +
* Department of Molecular, Cellular, and Developmental Biology, Yale University, New Haven, Connecticut 06520-8104, USA
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0123300|
 
Description = Similar to Cell cycle switch protein|
 
Version = NM_001055339.1 GI:115450406 GeneID:4331448|
 
Length = 3573 bp|
 
Definition = Oryza sativa Japonica Group Os03g0123300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:1305797..1309369|
 
CDS = 1305822..1306433,1306643..1306765,1306846..1306950,1307352..1307531,1307652..1307714<br>,1307815..1308009,1308368..1308469,1308549..1308611,1308709..1308777<br>,1308879..1308938|
 
GCID = <gbrowseImage1>
 
name=NC_008396:1305797..1309369
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:1305797..1309369
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactccgcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccgtcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccggcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcgctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctcccccggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgcgccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcctcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcaggttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgagggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctaggtcaccttataaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtggattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaatgcatgcagcagcaaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttcagtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcaggtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagtaggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatccttcaccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggaggtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaacagactttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcatacagcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtggaggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgcgtcgacacaggcagtcaggtctgtaatcttgtatggtcaaagaatgttaatgagcttgttagcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaagctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatggacagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatctcccaagtcccagagttctgacagcctaagtagcatcggggccacatcatttgttaggagctacatccggtga</cdnaseq>|
 
AA = <aaseq>MDHHHHHLPPPPPRSPMENSASSKPPTPASTPSSRLAAAPSSRV                    SSAAPHPSPSSSAPTPASRTVYSDRFIPSRAGSNLALFDLAPSPSHHDAAAAAASPGA                    PPPSGSTPASSPYCALLRAALFGPTTPDRVASSASACSSSSSAGASPVGSPATGNIFR                    FKAEVPRNAKRALFSDGDDEGVLFPGVFTTRGTGPRKIPRSPYKVLDAPALQDDFYLN                    LVDWSSHNILAVGLGNCVYLWNACSSKVTKLCDLGVDDNVCSVGWAQRGTHLAVGTNQ                    GKVQVWDATRCKRIRTMESHRMRVGALAWNSSLLSSGSRDKSILHHDIRAQDDYISRL                    AGHKSEVCGLKWSYDNRQLASGGNDNRLYVWNQHSAHPVLKYTEHTAAVKAIAWSPHL                    HGLLASGGGTADRCIRFWNTTTNMHLNCVDTGSQVCNLVWSKNVNELVSTHGYSQNQI                    IVWRYPTMSKLATLTGHTYRVLYLAISPDGQTIVTGAGDETLRFWNVFPSPKSQSSDS                    LSSIGATSFVRSYIR</aaseq>|
 
DNA = <dnaseqindica>26..637#847..969#1050..1154#1556..1735#1856..1918#2019..2213#2572..2673#2753..2815#2913..2981#3083..3142#atccccaaatctctcgcccccacccatggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactccgcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccgtcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccggcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcgctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctcccccggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgcgccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcctcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcaggttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgagggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctaggtcaccttataaggtgagaagtgttcgccttcgatttcatagtttctttcaattgatatggtctgtttcttgattgatgtttctttgaattgagaaaaacatggtctttattattcatctgctctgtaccaagaatcctgtgttatttgtcatgcataaagagactgatatgaaagcttattactcaaaatctcacatgaattttccttctgttgctcttaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtggattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaatgcatgcagcagcaaggtgagccaactgcggccatccatgcgcattcttgtttgggtacttgaagagggtttgtaaagaagtttattgctgtgcaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttcagtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcaggttagacgtatgcccctttctgaaatgatcagataacatagtcatgatccaccaaaatttggaacgatgccttagcttaatctttatctagagtgtcaatggaaacattgagaagtatacaactcacttatggaaagatcagaaaaattgcaatactattaacagtggacctaatttttcgcacaaataatatatgatagacgcagtagagttttatgactaaactgaatgactttcatttttactccaaagaatgaatttggtccattgtaatctctgtttacaaatgtgctgtagtatttgatgattatcgattaatcctgttgagctctgaaattggtatgcaatgctacaatttcaatttggtgtctgactgtcaccttggattttatcttatttaggtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagtaggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatccttcaccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggaggtgatctattttatacatcattatgaattttccgacatgtcagattcttggattatcctattgtgctcccttttgatatattcttataatatgcatattctgtttccaaacacctttcaggtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaacagagtaagaatgcatccatgaattgtttcttgattggatcattggtattacatggaattcaaggttgcaatttcttatgtccatatcaatgtctcttttccagctttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcatacagcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtggaggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgcgtcgacacaggcagtcaggtattttgctacacatctaatttctttagtgattgtgcagcccatgtttatagttctgaactttaatgaactcttgtttattctatttatagtaccatattaaataccgtggtatatggtatgtgaaataagcatgataactctcaatctttggacgcacttaaaaaattgaacatttctttagtcatgtcagttccgaaaagtaagaaatgtaggctgagctctattttcaatagtgaagttctatttcttgttttcatatctgaaaccttcacagaaatgccatgtcattaagactgtagagttaagcatattgttttttggtatgtactgaggacgctgagtgaatcttgaataggtctgtaatcttgtatggtcaaagaatgttaatgagcttgttagcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaaggtatgcttgcaagcttattcttaactcagtacgctttacctttttcttgtattaattgtgctcgatttctcctttgtagctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatggacaggtgaagttatctcttgagtctttgaatctactgaattctgtttattgtatctagaatattttggcatagctgtgtttttgacattttatgtcaacagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatctcccaagtcccaggtaccttttttaaaaatagtataattggtccttatttcaatttgaatgaaatttcactttcatatatagcttctaaataataattggtccttcaattacagagttctgacagcctaagtagcatcggggccacatcatttgttaggagctacatccggtgacactgagatgtggtaatctaataacacttggctcataagtcataacactactgcagcagagtgttgatgatcatcaatatcattccatttgtaccacttgcatcaccagttcatgaaccatcaaacctagccaaattttagagatagtaggatgcagaatggtgaaactggctcgcagacctcggagtggctcatttgctgaatgctgtatatatttattcattggctttgtaggagcgaagatggcaaacactgaccatccgcaatgtaccattgataagttcacggcctcctgtttttgtttttgctgagtcaacttggagctggagctcttatgtataccatgctagggcttaacaacattggccaactcatgatgctcattgcatccaagttggaatatgctaaggaagctggagaatttctggtgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055339.1 RefSeq:Os03g0123300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 02:07, 14 February 2017

The rice Os03g0123300 was reported as TE in 2012 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os03g0123300 <=> TE,TAD1,OsCCS52A,OsWD40-61

Function

  • TE encodes a rice homologue of Cdh1, and that TE acts as an activator of the anaphase promoting complex/cyclosome (APC/C) complex
  • Besides having a conserved role in regulating cell cycle, APC/C TE has a unique function in regulating the plant-specific postembryonic shoot branching and tillering, which are major determinants of plant architecture and grain yield.

Phenotypic analysis

  • The rice tiller enhancer (te) mutant displays a drastically increased tiller number.


Figure 1. Phenotype characterization of te mutant and map-based cloning of TE.(a) Phenotype of WT and te plants at the seventh leaf stage. (b) Phenotype of WT and te plants at the heading stage. (c) WT produces un-elongated lateral bud (left panel, arrowhead) on the elongated upper internodes, whereas te mutant produces additional tillers (right panel, arrowhead) from the elongated internodes. (d) Tiller number comparison between WT (blue) and te (red) plants at the heading stage. TTs, total tillers; LTs, lower node tillers; HTs, higher node tillers. LTs are the tillers outgrown from the un-elongated basal internodes. HTs are the tillers outgrown from the elongated internodes.[1].

Expression

  • TE coexpresses with MOC1 in the axil of leaves, where the APC/C TE complex mediates the degradation of MOC1 by the ubiquitin–26S proteasome pathway, and consequently downregulates the expression of the meristem identity gene Oryza sativa homeobox 1, thus repressing axillary meristem initiation and formation.

References

  1. 1.0 1.1 Lin Q, Wang D, Dong H, Gu S, Cheng Z, Gong J, Qin R, Jiang L, Li G, Wang JL, Wu F, Guo X, Zhang X, Lei C, Wang H, Wan J. Rice APC/C(TE) controls tillering by mediating the degradation of MONOCULM 1. Nat Commun. 2012 Mar 20;3:752. doi: 10.1038/ncomms1716. PubMed PMID: 22434195; PubMed Central PMCID: PMC3316886.

Labs working on this gene

  • National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China.
  • National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China.
  • Department of Molecular, Cellular, and Developmental Biology, Yale University, New Haven, Connecticut 06520-8104, USA

Structured Information