Difference between revisions of "Os02g0477700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Annotated Information)
 
(9 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0477700''''' was reported as '''''DWARF50''''' in 2012 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0477700''''' '''''<=>''''' '''''DWARF50''''','''''D50'''''
 
===Function===
 
===Function===
Please input function information here.
+
[[File:Figure1.JPG|right|thumb|527px|'''Figure 1.''' ''Phenotypes of rice d50 mutant, F71, in matured internodes.<ref name="ref1" />.'']]
  
Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, we observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c). Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets). These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components. These results are consistent with the results reported by Nishikubo et al. (2000). Nishikubo et al. also reported that parenchyma cells in F71 ectopically deposit polysaccharide-linked hydroxycinnamoyl esters in their cell walls. Thus, the d50 mutation in F71 appears to induce abnormally shaped and sized cells and ectopic deposition of cell wall components specifically in the parenchyma of elongated internodes. In other organs such as roots and leaves, abnormally shaped cells were not observed.
+
* '''''D50''''' encodes putative inositol polyphosphate 5-phosphatase (5PTase), which may be involved in phosphoinositide signalling required for many essential cellular functions, such as cytoskeleton organization, endocytosis and vesicular trafficking in eukaryotes.
 +
* The putative 5PTase, encoded by '''''D50''''', is essential for IM formation, including the direction of cell division, deposition of cell wall pectins and control of actin organization.
  
[[File:Figure1.JPG‎]]
+
===Phenotypic analysis===
 
+
* The d50 mutation induced abnormally oriented cell division, irregular deposition of cell wall pectins and thick actin bundles in the parenchyma cells of the IM, resulting in abnormally organized cell files of the internode parenchyma and dwarf phenotype.
Genetic analysis of d50 gene using F71
+
* Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, the researchers observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c).
 
+
* Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets).  
To identify the d50 gene, linkage analysis was performed using F2 populations derived from a cross between the F71 (japonica cv.) and Kasalath (indica cv.).We selected 188 F2 individuals showing the same phenotype of F71 and used them for linkage analysis with 131 restriction fragment length polymorphism (RFLP) markers. All analysed F2 dwarf plants showed japonica patterns at each RFLP marker (R1989, C196 and R1736), indicating that the d50 gene was located on the long arm of chromosome 2. In order to determine its exact location, we designed CAPS markers (Supporting Information Table S1) around the three RFLP markers based on the DNA sequences available from the Rice Genome Annotation Project (http://rice.plantbiology.msu.edu/cgi-bin/gbrowse/rice/). Linkage analysis using 2053 mapping plants showed that the d50 locus is positioned within a broad region with a genetic distance of 2.2 cM between E61832S and R1736 (Fig. 2a);none of the CAPS markers between E61832S and R1736 showed any evidence of recombination. Therefore, it was difficult to further map the d50 with F2 progenies from a cross between F71 and Kasalath.
+
* These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components.
 
 
===Expression===
 
Please input expression information here.
 
 
 
Positional cloning of d50 gene with DMT9 mutant allele
 
 
 
D50 locus has been known to be allelic with d12 (Murai et al. 1990), d32 (Sato et al. 2002) and DMT9 (originally
 
isolated from our research), which were derived from spontaneous mutation, g-ray irradiation and chemical mutagenesis with N-methyl-N-nitrosourea, respectively.These allelic mutants exhibit dwarf and abnormal internode parenchyma phenotypes similar to that of F71 (Supporting Information Fig. S1). To isolate the d50 gene, linkage analysis was performed using the F2 progenies collected from a cross between DMT9 and Kasalath. Linkage analysis using 990 mapping plants with CAPS markers between E61832S and R1736 progressively narrowed the d50 locus to a 43-kbp region (Fig. 2a). Within the 43-kbp region, six putative genes were identified. Sequence analysis of six putative genes in the DMT9 and its parent cultivar, Taichung 65, indicated a G-to-A mutation within one of the six putative genes. Sequence analysis of the products obtained from RT-PCR and RACE-PCR revealed that the candidate gene spans 3243 bp from the start to stop codon and encodes a 1080-aa peptide containing 11 exons and 10 introns (Fig. 2b). In the DMT9,G-to-A mutation at nucleotide 1023 results in theTGG codon (tryptophan) to a premature stop codon (Fig. 2b).
 
 
 
[[File:Figure 2.JPG]]
 
 
 
Expression pattern of D50 gene
 
 
 
To investigate the expression pattern of the D50 gene, we performed semiquantitative RT-PCR in various organs.
 
Strong D50 gene expression was detected in young third internodes and other organs, such as the seedling, root, leaf blade, leaf sheath and young flower (Fig. 6a), indicating that the D50 gene is expressed ubiquitously in various rice organs.We next used the GUS reporter gene to confirm the expression pattern of D50. In the 10 transgenic plants with a promoter–reporter construct, strong GUS expression was observed in the IM (Fig. 6b), young leaves (Fig. 6b, d) and root apex (Fig. 6c, e).The GUS activity was weak in elongating cells from leaves and roots and diminished in elongated cells (Fig. 6b, c). These results indicate that D50 is strongly expressed in young tissues. The effect of the d50 mutation was observed only in the internode parenchyma and not in other organs such as the root and leaves, suggesting that D50 or hydrolysis of a unique D50 substrate is essential for the accurate formation of the internodes, and other 5PTases in rice may redundantly function in other organs.
 
 
 
[[File:Figure 6.JPG]]
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Graduate School of Bio-Applications and Systems Engineering, Tokyo University of Agriculture and Technology, 2-24-16
 +
Naka-cho, Koganei, Tokyo 184-8588, Japan,
 +
* Graduate School of Agriculture, Tokyo University of Agriculture and Technology, Fuchu, Tokyo 183-8509, Japan,
 +
* Kyushu Okinawa Agricultural Research Center, 496 Izumi, Chikugo, Fukuoka 833-0041, Japan
 +
* Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601 and 5 College of Bioresource Sciences, Nihon University, 1866 Kameino, Fujisawa, Kanagawa 252-0880, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Sato-Izawa K, Nakaba S, Tamura K, Yamagishi Y, Nakano Y, Nishikubo N, Kawai S,
 +
Kajita S, Ashikari M, Funada R, Katayama Y, Kitano H. DWARF50 (D50), a rice
 +
(Oryza sativa L.) gene encoding inositol polyphosphate 5-phosphatase, is required
 +
for proper development of intercalary meristem. Plant Cell Environ. 2012
 +
Nov;35(11):2031-44. doi: 10.1111/j.1365-3040.2012.02534.x. PubMed PMID: 22574770.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0477700|
 
Description = Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein)|
 
Version = NM_001053379.1 GI:115446128 GeneID:4329359|
 
Length = 4131 bp|
 
Definition = Oryza sativa Japonica Group Os02g0477700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:17139056..17143186|
 
CDS = 17142042..17142192,17142278..17142399,17142943..17143185|
 
GCID = <gbrowseImage1>
 
name=NC_008395:17139056..17143186
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:17139056..17143186
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>tctccagggcctattgacaacattatgcgttctactttgattgaggctgagccattatacaaacaatttgaatacatgaaagtgttggtgggttcttggaatgtcgggcaagaaaaggcatcttatgagtcactaagagcttggctaaagttaccgacaccagaggttgggttagtggtagttggattgcaggaggtggacatgggtgctggttttcttgcaatgtctgcagctaaagaaacagttgggctagagggaagcccaaacggagattggtggttggatgcaattgggcagcagttaaagggttactcttttgagcgtgttggctcgaggcagatggctggattgcttatctgtgtatgggtcagaacacatcttaagcagttcattggtgatattgataatgctgcggtagcatgtggattagggcgagcaatcggcaacaaggtacttctgttatcttattgccccactctttcttggcgcaagatgagcttgaaatgttgtttatga</cdnaseq>|
 
AA = <aaseq>SPGPIDNIMRSTLIEAEPLYKQFEYMKVLVGSWNVGQEKASYES                    LRAWLKLPTPEVGLVVVGLQEVDMGAGFLAMSAAKETVGLEGSPNGDWWLDAIGQQLK                    GYSFERVGSRQMAGLLICVWVRTHLKQFIGDIDNAAVACGLGRAIGNKVLLLSYCPTL                    SWRKMSLKCCL</aaseq>|
 
DNA = <dnaseqindica>995..1145#788..909#2..244#atctccagggcctattgacaacattatgcgttctactttgattgaggctgagccattatacaaacaatttgaatacatgaaagtgttggtgggttcttggaatgtcgggcaagaaaaggcatcttatgagtcactaagagcttggctaaagttaccgacaccagaggttgggttagtggtagttggattgcaggaggtggacatgggtgctggttttcttgcaatgtctgcagctaaagaaacagtaagtcaagtttaagttctagtttttttaattaaagttatttgaacacatgtttttgttatttacttgcacttagtcatctgctactattatacagaccaaatcctagtaacactgaacaagagtgttgttagacatcttgctcttgttgattttttttgttgaataatcattatcattatgtataagatacctcgttgtacaaatgtacaatgttatcttgaccacaaaaaaatacgcttgtttgacaggctgtacctcttttctctatcagtatgattagagttaagctattttttgccacagttttattaaatgtctacaatacaacactgattggcacaggatccatgtgccatccttgcaatgagtggcagcatatggatgaaactcaatgacacaatgatttaaccttgtcttgcactcttgctaaagatcgttctgccgttagacttcccaagaatattaataaagtataacatgaaactggcatggtttttgctacttctaatcctgatacttttgtacgtccacttgctttaggttgggctagagggaagcccaaacggagattggtggttggatgcaattgggcagcagttaaagggttactcttttgagcgtgttggctcgaggcagatggctggattgcttatctgtgtatggtaatctgttcaggacttattttatcctgcagcttcatctgccttttgtttgtgtataaattattcagtttcttctttttctcagggtcagaacacatcttaagcagttcattggtgatattgataatgctgcggtagcatgtggattagggcgagcaatcggcaacaaggtacttctgttatcttattgccccactctttcttggcgcaagatgagcttgaaatgttgtttatgaggcatttgacttatcaaacatatcatgacaaattttgttttgatctaagcatttcatgctttagccatcatatttattggagatgtgttcatattctggaacatttgagttaagggggggaatacctttgctggccactatatgccaaaactccctttcatgtttaagcacaatgctgattagttcattctagagaaaggtagcaaggaggataagatataccatataggcatacagtatataataaaaaggaatatatgctatatgatggaaatgtagtgtgacagcaagtgctatttgatttgttttctttcatgcattcacatgttgaacattgtttgtttacttgtttaaaatgaacatcttggaagttctgaaagttcaagttgttaacgatgcactaagcaaaaagattattcacatttgtccccatattcatttggtagcagttgttgtgcaaaaccaataaatcattgttaccaagatgatatctggtggtttgtgcatacaattaatgaatgagaggtgtgcaatactgatcagaaaatgaaaaaaaaaagacaaattttaaaacacattatgggcctaaaatgtaaccacccactagttctgttatttttctgggggagtacagatattacttcaaaaggactgtattctgtcttatctgctgctttgttcatgtatgcctatattagggagcagtgggattgaggatgagaatacatgataggagtatttgctttgtaaattgccattttgctgctcatatggaagctgtgagtcgacggaatgaagattttgaccatgtctttagaacaatgacctttgccaccccttcgagtggaataatgacaacatcaggtgtttgttcaaccttttcccattatttttcagtattttccaatgggcattcaagtcaaatgacctgtaaatttgttgtgatattacaatcagcaatgagcaaatcttatacactgttacttgttttggtggtcttgcagtttctagttctactggccagcttcttcgaggagcaaatgtatggtgtattaatgttggttcattacattttctcggtggatagggagtagattctcatcttgatatactaagttgttcctattataatttacagggatcaagaatgcctgagttgtcagacacggacatgattgtctttcttggtgacttcaattaccgcctttatgatatttcctatgatgatgcaatgggcttagtttcccggagatgctttgactggctaaaaaataatgaccaactgcgagcagaaatgagatctgggagagtcttccagggactacgtgaaggggatttcaagtttccccctacatacaaatttgagaaacatacagcaggcttatcaggtatcttactttgttttttattcgtggaatcccaaagtacatataaagatcatcacctttatttgtcatatagggtatgatagcagtgagaagaggcgcattcctgcctggtgtgacagaatcctatatcgtgatagccgagttagttcagggaatgagtgttccttggattgtcctgtggtttcttcaatatcactgtaagttatttgttgtgcatgtttttttttaacccgaaaaagcttaaaatatgtcaataccttgttattatgttttccaggtatgactcttgcatggaagcaacagatagtgatcacaaacctataaaatctgtgttcaatttggatattgcttatgttgacaaacagacaatgaggcagaaatatgtggagctaatgagctcaaataataaagtggtgcatttgcttcaggaacttgaagcattccctggagtaaatataaataattctaacatcatcttgcaagatcggaatccatctgttgtgaaattgcaaaacagaacagaagtcatcgcttgttttgagatcattggacaagcaccaaatttgtccagcacacatttctctgcttttcctgcatggctaaaggtgagtcaatgctttgtctgactccttttactgtatttttattaaaataatctaatactagcaacgtacaaaaactttgcacgaccgaatttctcatgttttacatgggcacaactgcagagtagtagaaatattagtctcttcagtatcaagagttatgacaaaagagagcatatggtttcagttatactccctccgtttcaggttataagacgttttgactttggtcaaagtcaaactacttcaaatttgattaagtttatagacaaatatagtaatatttataatactaaattagtttattaaatcaataattgaatatatttttataataaatttgtcttgggttgaaaatgttattattgttttctacaaacttagtcaaacttgaagtaatttgactttgaccaaagtcaaaaacatcttataacctgaaacggaggtagtagtagattgacgcgttggcattagtaaaggcagactccagaatttgttattacttgttttgcttgttttattcttcaccattattaattcactgttgtgagcttaatgttttgaaaactgtgggcatatattcaatataggtctctccagcagtcggcataatatctccgggacagacggtagaggtcactttgcagcacagagacctgcatagccaacaaaactataatggaacttcattggatattttgcctggtggagctacccaacaaaaggcagcaactgtttttgcgaaaataactggagtatattcaacagttgcaaaatattacgaaatacatgtacaacaccagaactgcaggagcacattgccatcgagaggttataacttaggtgaccggtttttttaattttgagtttggtatcaggaatttaggaaatgtatgttgtatcaaatgttctttttgagtgaagtcacaaaatcaaggctttctactaccctcaacatgtgtattttcaagagaggaaaattgtaaacagtgtagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053379.1 RefSeq:Os02g0477700]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 02:28, 14 February 2017

The rice Os02g0477700 was reported as DWARF50 in 2012 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os02g0477700 <=> DWARF50,D50

Function

Figure 1. Phenotypes of rice d50 mutant, F71, in matured internodes.[1].
  • D50 encodes putative inositol polyphosphate 5-phosphatase (5PTase), which may be involved in phosphoinositide signalling required for many essential cellular functions, such as cytoskeleton organization, endocytosis and vesicular trafficking in eukaryotes.
  • The putative 5PTase, encoded by D50, is essential for IM formation, including the direction of cell division, deposition of cell wall pectins and control of actin organization.

Phenotypic analysis

  • The d50 mutation induced abnormally oriented cell division, irregular deposition of cell wall pectins and thick actin bundles in the parenchyma cells of the IM, resulting in abnormally organized cell files of the internode parenchyma and dwarf phenotype.
  • Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, the researchers observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c).
  • Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets).
  • These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components.

Labs working on this gene

  • Graduate School of Bio-Applications and Systems Engineering, Tokyo University of Agriculture and Technology, 2-24-16

Naka-cho, Koganei, Tokyo 184-8588, Japan,

  • Graduate School of Agriculture, Tokyo University of Agriculture and Technology, Fuchu, Tokyo 183-8509, Japan,
  • Kyushu Okinawa Agricultural Research Center, 496 Izumi, Chikugo, Fukuoka 833-0041, Japan
  • Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601 and 5 College of Bioresource Sciences, Nihon University, 1866 Kameino, Fujisawa, Kanagawa 252-0880, Japan

References

  1. 1.0 1.1 Sato-Izawa K, Nakaba S, Tamura K, Yamagishi Y, Nakano Y, Nishikubo N, Kawai S, Kajita S, Ashikari M, Funada R, Katayama Y, Kitano H. DWARF50 (D50), a rice (Oryza sativa L.) gene encoding inositol polyphosphate 5-phosphatase, is required for proper development of intercalary meristem. Plant Cell Environ. 2012 Nov;35(11):2031-44. doi: 10.1111/j.1365-3040.2012.02534.x. PubMed PMID: 22574770.

Structured Information