|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os03g0717700''''' was reported as '''''OsHk4''''' in 2012 <ref name="ref1" /> by researchers from Korea. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0717700''''' '''''<=>''''' '''''OsHk4''''','''''HK4'''','''''Ohk4''''','''''HISTIDINE KINASE 4''''' |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * '''''OsHk4''''' and '''''OsHk6''''' mediated the canonical two-component signaling cascade of Arabidopsis to induce phosphorylation of ARR2. |
| | + | * The action mechanism of '''''OsHks''''' is evolutionarily diverged from bacterial histidine kinases. |
| | + | * '''''OsHks''''' are homomeric cytokinin receptors with distinctive cytokinin preferences in rice. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * '''''OsHk4''''' and '''''OsHk6''''' were highly expressed in spike- lets, suggesting that tZ and iP might play key roles in grain development. |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Department of Life Sciences and Functional Genomics Center, Pohang University of Science and Technology, Pohang 790-784, |
| | + | * Korea Crop Biotech Institute, Kyung Hee University, Youngin 446-701, Korea |
| | + | * Department of Plant Molecular Systems Biotechnology, Kyung Hee University, Youngin 446-701, Korea |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Choi J, Lee J, Kim K, Cho M, Ryu H, An G, Hwang I. Functional identification |
| | + | of OsHk6 as a homotypic cytokinin receptor in rice with preferential affinity for |
| | + | iP. Plant Cell Physiol. 2012 Jul;53(7):1334-43. doi: 10.1093/pcp/pcs079. PubMed |
| | + | PMID: 22642989. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]] |
| − | GeneName = Os03g0717700|
| |
| − | Description = Response regulator receiver domain containing protein|
| |
| − | Version = NM_001057618.1 GI:115454964 GeneID:4333916|
| |
| − | Length = 2482 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0717700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:29816512..29818993|
| |
| − | CDS = 29817060..29817553,29818174..29818432|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:29816512..29818993
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:29816512..29818993
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgttgctaatcgagagtgattcctggggaccacagatggatgtctccttacatgctagacttcaggagatgaaacagagtgatcgcatacatgtattgcccaaggttttccttctttctgctgcagaatcagacaaagtaaagaagatacatgcagttgattctgtgataccaaagcctctgaaagcaagtgcacttgcggcctgtctgttccaagcacttggtatcacacagccgagccatgagaaacgtgacgattcaggttctcttcatgggcgtgatggttcaggttctcttcatgggttgcttcttggcaagaacatattggtagttgatgacaacaaggtaaacctcagagtggccgctggtacattgaagaaatatggggcaaaggtggagtgtgtggagagtggaaaagatgctctttcccttctacaagtgccgcacaagtttgatctgtgtctcatggacattcagatgccggagatggatggatttgaggcaactcggcaaatacgagcaatggaagggaaggcaaatgagcaggcagacgacagcgaatcgggttcagaaatcgcagcaaagacggccaaatggcacttgccaatcctggcaatgaccgctgatgtcatccaggccacccacgaggaatgcacaaagtgcgggatggatggctacgtctcgaagccctttgaggagaagcagctcttccaggcagtacagaagttcttgggcccatgcgtttccagctga</cdnaseq>|
| |
| − | AA = <aaseq>MLLIESDSWGPQMDVSLHARLQEMKQSDRIHVLPKVFLLSAAES DKVKKIHAVDSVIPKPLKASALAACLFQALGITQPSHEKRDDSGSLHGRDGSGSLHGL LLGKNILVVDDNKVNLRVAAGTLKKYGAKVECVESGKDALSLLQVPHKFDLCLMDIQM PEMDGFEATRQIRAMEGKANEQADDSESGSEIAAKTAKWHLPILAMTADVIQATHEEC TKCGMDGYVSKPFEEKQLFQAVQKFLGPCVSS</aaseq>|
| |
| − | DNA = <dnaseqindica>549..1042#1663..1921#aaaggcttggaatcacttctgaagttgttggtaccattgatccgacatttggtgtgttgtctgggagaaatggcagttctctaaccaggtacttctatcttctacattcctttcaaaaaattgaaatcctggagttaataggctacttttctctggaaattagaataaacggagcatgcttgcatactaacttcttatgcaaatatcactgttctatgtataaatgattacacgataatgattgttttttggtaagtattactgggtaatacttggccatcatagttcttgcctttattttgtatcacttcggtatattgctacttctgcggcagttctctttacgctaccgaatgtgatatatttaattgaaaattgattttattttaatctgtgaaaagaacatttttttaaggccccacaattctcaaataactagtaagctgattgcagatgatatttgaactatcttgacacccagtttttttttttaatctaactcgttttgttccaaatttgttgtcagcattggtaagaagcagccatgcatgttgctaatcgagagtgattcctggggaccacagatggatgtctccttacatgctagacttcaggagatgaaacagagtgatcgcatacatgtattgcccaaggttttccttctttctgctgcagaatcagacaaagtaaagaagatacatgcagttgattctgtgataccaaagcctctgaaagcaagtgcacttgcggcctgtctgttccaagcacttggtatcacacagccgagccatgagaaacgtgacgattcaggttctcttcatgggcgtgatggttcaggttctcttcatgggttgcttcttggcaagaacatattggtagttgatgacaacaaggtaaacctcagagtggccgctggtacattgaagaaatatggggcaaaggtggagtgtgtggagagtggaaaagatgctctttcccttctacaagtgccgcacaagtttgatctgtgtctcatggacattcagatgccggagatggatgggtaagcttatgtcccgttcaagatttatttcttttgaatttgagccttttatttcatatgatccaaagcgtgacatgtcatctggataagtgccacctcgttgactatcaatttattcacgcaatgaatcaggctttctgcctctttttgaagaaaaaaaaaatgttattcacacttcgtggttaatggaaacaagcatatacattgctgacgccaaatactgattataactagtaaaaatgtcagtcttgtgttagttttttatgtgcgaaaaatgccgtgtctaattcattatgtgaaaattttcaaagacattagccctgatatcgtcctgcattatgccaaacagtactttaaatattaatatcagaaggtctaaaatccgtgcagttaccatttgttcattgtagttttaaccatcatactgcaatatgcagttcttgggctaatgaacataatggtgtgctaacaccctcatgaccaattaacttatgtctcttgaacacttgctgcatattgacatctctgttcctatattttctgaatagtaaccaagtaatgtcaaaccatgtcattattttgtcttcgtttaatcaacatagttttgcttcatgtgctagatttgaggcaactcggcaaatacgagcaatggaagggaaggcaaatgagcaggcagacgacagcgaatcgggttcagaaatcgcagcaaagacggccaaatggcacttgccaatcctggcaatgaccgctgatgtcatccaggccacccacgaggaatgcacaaagtgcgggatggatggctacgtctcgaagccctttgaggagaagcagctcttccaggcagtacagaagttcttgggcccatgcgtttccagctgacaccaaccgatgcattctgctgtacaccaagagagtaaagaatgagcactgactgtgaactgaggcggctaaaattcttctccattttgttgctcttcaacagaggatgcgatctgaatgagagcctgcactcaaggcgacattgcacagaaaggatcggagccttcattgtgtacatgtatttttatcggcagagaccaagagctatagttttaagctaggagaagcataagttttagggtgacatgtccggcctcctgttatcggagccacaggtgtgttgctgggctattggaatcttgagcaatttttttttcctgtacagctcccacgatttttcggctccagcccactgttgacagaagacatgtttgcagggtgcagcatcttggaaaaacctgataacctgagaattttttgttgtgtcattctgtgtgcagtatattagaatttgagcagtattgtatatcaatgtaccatcggtgtatggatgtgaacaaggaaggcgaaacctgtgattaggacactgattaaaacttgcactcgttttttccatcccgt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057618.1 RefSeq:Os03g0717700]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 3]]
| |
| − | [[Category:Chromosome 3]]
| |