|
|
| (5 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os09g0518200''' was reported as ''' OsSGT1''' in 2009 <ref name="ref1" /> by researchers from the Japan. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''Os09g0518200 <=> OsSGT1''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | *The '''OsSGT1''' gene may contribute to the SA signaling mechanism by inducing up-regulation of SAG in rice plants. |
| − | | |
| − | ===Expression===
| |
| − | Please input expression information here.
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| − | You can also add sub-section(s) at will.
| + | ===Mutant=== |
| | + | *RNAi-mediated silencing of the '''OsSGT1''' gene significantly reduced the probenazole-dependent development of resistance against blast disease, further supporting the suggestion that OsSGT1 is a key mediator of development of chemically induced disease resistance. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | *Agricultural & Veterinary Research Laboratories, Meiji Seika Kaisha Ltd, Yokohama 222-8567, Japan, |
| | + | *Gene Research Center, Ibaraki University, Ami, Ibaraki 300-0393, Japan, |
| | + | *Department of Biomolecular Engineering, Graduate School of Engineering, Tohoku University, Sendai 980-8579, Japan, |
| | + | *Food and Health R&D Laboratories, Meiji Seika Kaisha Ltd, Sakado, Saitama 350-0289, Japan, |
| | + | *Graduate School of Environmental Engineering, Kitakyushu University, Kitakyushu, Fukuoka 808-0157, Japan, and |
| | + | *Department of Biology, Tokyo Metropolitan University, Hachioji, Tokyo 192-0397, Japan |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1"> |
| | + | Contribution of salicylic acid glucosyltransferase, OsSGT1,to chemically induced disease resistance in rice plants |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]] |
| − | GeneName = Os09g0518200|
| |
| − | Description = UDP-glucuronosyl/UDP-glucosyltransferase family protein|
| |
| − | Version = NM_001070220.1 GI:115480182 GeneID:4347593|
| |
| − | Length = 1817 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os09g0518200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:20875818..20877634|
| |
| − | CDS = 20875872..20876543,20876634..20877371|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:20875818..20877634
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:20875818..20877634
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgagctcagagcgcggcggcggcggcggcatccacgtcgtcttgctcccgtacccgagccaaggccacatcaatccgatcctccagttcggcaagcgcctcgccggccatggcggcgtccggtgcaccctcgccgtgacgcggttcatcctccgccagggcgagccgccgtccacgggcgccgtccacgtcgccgcctactccgacggctacgacgccggcggcttccacgaggccggcagcgccggcgagtacctgtcccggctggagtcgcgcgggtcggacaccatggacgcgctcctccgcgccgaggcggagcagggccggccggtggacgcggtggtgtacgactcgttcctgagctgggcgccgcgcgtggcggcgcgccacggtgcggcgaccgcgtccttcttcacgcaggcgtgcgcggtgaacgcggcgtacgagagcgtgttcacgggccgggtcgagctgccgctcgccgccgacggcgaggagccgctacggctgcccgggatttccgtcggcctcacgctggacgacgtgccgacgttcatggcgaacacggaggacagcccggcgtacctcgacctcctggtgaaccagttcaagggcctggacatggccgaccatgtcctcgtcaactccttctacgagctccagccacaggaagcggagcacatggcgtcggcgtggcgggccaagacggtggggctgaccgtgccatcggcgtacctcgacaaccgcctcccggacgacacgtcgtacggcttccacctcttctcgccgacgacggagacgaaggcctggctggaggcgagaccaccgcgcaccgtggcgtacgtctccttcggcagcgtggcgacgccgagcccggcgcagatggccgaggtggcggagggtttgtacaacaccggcaagcccttcctctgggtggtgagggcatcggaaacctccaagataccggaaggcttcgccgccaaggcggcgaagcaagggagagggctcatcgtgacgtggtgcccgcagctggaggtgctggcacacccagctgtggggtgcttcgtgacgcactgcgggtggaactcaacgacagaggggttgagtgccggtgtaccaatggtggcggtaccgcagtggtcagaccagacaatgaatgccaagtacattgaggacgtgtggcgtgttggggtgcgggtgcggcccgacggcgagggggtggtgaggaaggaggagttggagaggtgtgtgagggaggtgatggaaggggagaggagcaaggagttcatggagaatgctaatggttggaaggagaaggccagaaatgccatgtgtgaaggtggcagctccgacaaaaatatcgtcgagttcatcgctaagattggagtggaccgaaaatttaaatga</cdnaseq>|
| |
| − | AA = <aaseq>MASSERGGGGGIHVVLLPYPSQGHINPILQFGKRLAGHGGVRCT LAVTRFILRQGEPPSTGAVHVAAYSDGYDAGGFHEAGSAGEYLSRLESRGSDTMDALL RAEAEQGRPVDAVVYDSFLSWAPRVAARHGAATASFFTQACAVNAAYESVFTGRVELP LAADGEEPLRLPGISVGLTLDDVPTFMANTEDSPAYLDLLVNQFKGLDMADHVLVNSF YELQPQEAEHMASAWRAKTVGLTVPSAYLDNRLPDDTSYGFHLFSPTTETKAWLEARP PRTVAYVSFGSVATPSPAQMAEVAEGLYNTGKPFLWVVRASETSKIPEGFAAKAAKQG RGLIVTWCPQLEVLAHPAVGCFVTHCGWNSTTEGLSAGVPMVAVPQWSDQTMNAKYIE DVWRVGVRVRPDGEGVVRKEELERCVREVMEGERSKEFMENANGWKEKARNAMCEGGS SDKNIVEFIAKIGVDRKFK</aaseq>|
| |
| − | DNA = <dnaseqindica>55..726#817..1554#gtgcaagcgtatcacagttcacaaaagcagcacagagctagtctagtggcagccatggcgagctcagagcgcggcggcggcggcggcatccacgtcgtcttgctcccgtacccgagccaaggccacatcaatccgatcctccagttcggcaagcgcctcgccggccatggcggcgtccggtgcaccctcgccgtgacgcggttcatcctccgccagggcgagccgccgtccacgggcgccgtccacgtcgccgcctactccgacggctacgacgccggcggcttccacgaggccggcagcgccggcgagtacctgtcccggctggagtcgcgcgggtcggacaccatggacgcgctcctccgcgccgaggcggagcagggccggccggtggacgcggtggtgtacgactcgttcctgagctgggcgccgcgcgtggcggcgcgccacggtgcggcgaccgcgtccttcttcacgcaggcgtgcgcggtgaacgcggcgtacgagagcgtgttcacgggccgggtcgagctgccgctcgccgccgacggcgaggagccgctacggctgcccgggatttccgtcggcctcacgctggacgacgtgccgacgttcatggcgaacacggaggacagcccggcgtacctcgacctcctggtgaaccagttcaagggcctggacatggccgaccatgtcctcgtcaactccttctacgagctccagccacaggtatatatacgtgatctgatccaagctcgccataaatttgtccatggcgtgtgcaagccgatcacgatcaatgtcgtcgcctgttggtaggaagcggagcacatggcgtcggcgtggcgggccaagacggtggggctgaccgtgccatcggcgtacctcgacaaccgcctcccggacgacacgtcgtacggcttccacctcttctcgccgacgacggagacgaaggcctggctggaggcgagaccaccgcgcaccgtggcgtacgtctccttcggcagcgtggcgacgccgagcccggcgcagatggccgaggtggcggagggtttgtacaacaccggcaagcccttcctctgggtggtgagggcatcggaaacctccaagataccggaaggcttcgccgccaaggcggcgaagcaagggagagggctcatcgtgacgtggtgcccgcagctggaggtgctggcacacccagctgtggggtgcttcgtgacgcactgcgggtggaactcaacgacagaggggttgagtgccggtgtaccaatggtggcggtaccgcagtggtcagaccagacaatgaatgccaagtacattgaggacgtgtggcgtgttggggtgcgggtgcggcccgacggcgagggggtggtgaggaaggaggagttggagaggtgtgtgagggaggtgatggaaggggagaggagcaaggagttcatggagaatgctaatggttggaaggagaaggccagaaatgccatgtgtgaaggtggcagctccgacaaaaatatcgtcgagttcatcgctaagattggagtggaccgaaaatttaaatgattgagacaggtggattcgtcggccattggtcatgtttcctttctcatttgatttcactatcatgttttcagatgcaataatagtcgttatctgtcgctctagtctttctttttctagtataggatcaaatatttgcgatatctttttcccactatattcaatgaaatgggcacagtcggatgccgattcgttaaaaaaatattttacgatatgtatagtaaaataatcagtcatcagtcaatgcattaattgcatagttgttc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070220.1 RefSeq:Os09g0518200]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 9]]
| |
| − | [[Category:Chromosome 9]]
| |
