Difference between revisions of "Os02g0491300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(16 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0491300''''' was reported as '''''MTR1''''' in 2012 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0491300''''' '''''<=>''''' '''''OsMTR1''''','''''MTR1'''''
 +
[[File:221-Os02g0491300.png|right|thumb|427px|'''Figure 1.''' ''Phenotypic Analysis of mtr1 Anthers.<ref name="ref1" />.'']]
 
===Function===
 
===Function===
Please input function information here.
+
* MICROSPORE AND TAPETUM REGULATOR1 ('''''MTR1''''') is a rice fascilin glycoprotein protein.  
MICROSPORE AND TAPETUM REGULATOR1 (MTR1) is a rice fascilin glycoprotein protein. It may act as an extracellular adhesion molecule in male reproductive development by regulating the cell-to-cell communication between reproductive cells and their adjacent somatic cells.
+
* '''''MTR1''''' may act as an extracellular adhesion molecule in male reproductive development by regulating the cell-to-cell communication between reproductive cells and their adjacent somatic cells.
 
+
* '''''MTR1''''' can controll the development of sporophytic and reproductive cells in rice (Oryza sativa).
* an essential gene for programmed tapetal cell fate and pollen formation in rice.
+
* '''''MTR1''''' is an essential gene for programmed tapetal cell fate and pollen formation in rice.
 
+
* '''''MTR1''''' is required for both the development of the diploid anther wall cells and maturation of the postmeiotic haploid microspores.
* is required for both the development of the diploid anther wall cells and maturation of the postmeiotic haploid microspores.
+
* '''''MTR1''''' effect the deposition of sporopollenin precursors on the surface.
 
 
* effect the deposition of sporopollenin precursors on the surface.
 
  
 
===Gene Structure===
 
===Gene Structure===
Please input Gene Structure information here.
+
* ''MTR1'' locus was located on chromosome 2 between two InDel markers, TH239 and TH234. The MTR1 transcript is approximately 2 kb in length and contains a 1,752 bp coding sequence without any intron, a 55 bp 5' untranslated region (UTR) and a 193 bp 3' UTR.  
 
+
* The predicted MTR1 protein is 583 amino acids long and contains a putative N-terminal signal peptide; two fasciclin domains (amino acids 257–356 and 435–535); and two potential N-glycosylation sites (amino acids 433 and 554).
''MTR1'' locus was located on chromosome 2 between two InDel markers, TH239 and TH234. The MTR1 transcript is approximately 2 kb in length and
+
[[File:MTR4.jpg|right|thumb|427px|'''Figure 6.''' ''Map-Based Cloning analysis of MTR1<ref name="ref1" />.'']]
contains a 1,752 bp coding sequence without any intron, a 55 bp 5' untranslated region (UTR) and a 193 bp 3' UTR. The predicted MTR1 protein is
 
583 amino acids long and contains a putative N-terminal signal peptide; two fasciclin domains (amino acids 257–356 and 435–535); and two potential N-glycosylation sites (amino acids 433 and 554).
 
 
 
[[File:MTR4.jpg]]
 
 
 
 
===Mutation and Phenotype===
 
===Mutation and Phenotype===
Please input Mutation and Phenotype information here.
+
* mtr1 shows normal vegetative and nonreproductive floral organ development, but has smaller and pale-yellow anthers that fail to produce viable pollen grains (Figures S1A–S1F available online; Figures 1A and 1B).  
 
+
* All the F1 progeny from the backcross between wild-type and mtr1 displayed the wide-type phenotype, and the F 2 progeny yielded a segregation of 481 wild-type and 147 mutant plants (c 2 = 0.85,p > 0.05), suggesting a monofactorial recessive inheritance of the mutation.
''mtr1'' shows normal vegetative and nonreproductive floral organ development, but has smaller and pale-yellow anthers that fail to produce viable pollen grains.(A: wiletype; B: ''mtr1'')
+
* To characterize the defects of anther development in mtr1, researchers performed 4 0 ,6-diamidino-2-phenylindole (DAPI) staining of microspores.
 
+
# At stage 8b of anther development, mtr1 produced normal tetrads just like the wild-type (Figures 1C and 1D). However, at stages 9 and 10, after the microspores were released from the tetrad, mtr1 microspores expanded much more slowly than those of the wild-type (Figures 1E–1H).  
[[File:MTR1.jpg]]
+
# At later stages, each wild-type microspore underwent mitosis, gener- ating the mature trinucleate pollen grain that contains two smaller sperm nuclei and a larger vegetative nucleus (Figures 1I and 1K).  
 
+
# By contrast, mtr1 microspores continued to show slow development, did not seem to go through mitosis, and were eventually aborted (Figures 1J and 1L).
The result of (DAPI) stain show that start from stage 9 ''mtr1'' microspores  show slow development, did not seem to go through mitosis, and were eventually aborted. Transverse section analysis showe ''mtr1'' anther wall layers were less degenerated than wild-type and microspores were collapsed.transmission electron microscopy (TEM) and scanning electron microscopy (SEM) of the anther show ''mtr1'' tapetal cells were highly vacuolated and microspores were irregularly shaped with less deposition of sporopollenin precursors on the surface. And, at stage 7 and 8b, when wild-type tapetal cells showed TUNEL-positive nuclei. However, the ''mtr1'' tapetal cells had no detectable TUNEL signals. Several rice tapetum-expressed genes, which are known to be involved in tapetal function and degeneration, displayed abnormal expression patterns in ''mtr1'' .
 
 
 
[[File:MTR2.jpg]]
 
 
 
===Expression and Location===
 
Please input expression and location information here.
 
RT-PCR, RNA in situ hybridization and translational fusion between the full-length ''MTR1'' coding region and GFP (Green Fluorescent Protein) under the control
 
of MTR1’s native promoter (pMTR1:MTR1-GFP) all show the expression of ''MTR1'' only in the anthers(specifically in the microsporocytes and the
 
tetrads).  
 
The ''MTR1'' transcripts started to be detectable at stage 7 and reached the maximum level at stage 8a, when meiosis occurs to form dyads. At stage 9, when the young microspores are released from the tetrad, the transcript level of MTR1 began to decrease and was hardly detectable at stage 10.
 
 
 
[[File:MTR3.jpg]]
 
 
 
MTR1 was found to localize in the microsporocyte cytoplasm, in the extracellular matrix between the microsporocytes, and at the interface between the microsporocyte and the tapetal cell. And the N-terminal peptide, which is required for MTR1’s localization on the plasma membrane, is critical for MTR1’s role in rice anther development.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology Center, Key Laboratory of Genetics & Development and
 +
* Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, MI 48824, USA
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Tan H, Liang W, Hu J, Zhang D. MTR1 encodes a secretory fasciclin glycoprotein
 +
required for male reproductive development in rice. Dev Cell. 2012 Jun
 +
12;22(6):1127-37. doi: 10.1016/j.devcel.2012.04.011. PubMed PMID: 22698279.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0491300|
 
Description = Conserved hypothetical protein|
 
Version = NM_001053407.2 GI:297599244 GeneID:4329387|
 
Length = 2000 bp|
 
Definition = Oryza sativa Japonica Group Os02g0491300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:17929370..17931369|
 
CDS = 17929425..17931176|
 
GCID = <gbrowseImage1>
 
name=NC_008395:17929370..17931369
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:17929370..17931369
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgctcctcttccgcatctcgctcctcctcctcctcgtcccactcatccccaccgccgccgcgtcccaccaccactcgccggcgggaggaggaggagcggcggtgccgcttcacccgcgccgccaccaccgctccgtcgcgaacacggccacggcgctgttctaccccgccccttccatgcaccagaaccacatcgaggcggaggagggccagttgctgcacgtgctcgccgaccccttcgccgccgcgcccgccgctgccgaggctccgtccggggagaccgccatcgccgcggtgggagcggcggcggaggaggcgacccctacgctgatcgacgactccccgcagcaagcagcggccgcatcaccaccaccaccaccaccacctcctcctcctcctcctcctctcttcgccaagccggatctggactccacggcgccaccgcagccgaaggaggagggcgtggacgggtacgggtcgacgacggcgacggcgacggtgacagcggctccgccactcgacgaacctgctgcagccacggccacgaccacgaccacgaccacgacgacgcttccgctcccgaggtacagccacgtagcgagccctcctccgcctccagtccacgccggggtcgcgggcttgggcgacgagcagcgcctggagcagctggcgagggtgctctcctcgctggggtacaacgagatggcctcggcggcgctgctcctcgccaactcggcgttgctcgcggcgtggccagggtcgatcaccgtcttcgcggctcccgacgtcttcctccgcgcctcttgccccatgtgctcgcgccgccatgtcctactggagcacatcgccctgggctacttcccctacaccgagctcgccgccgcctccaccgccaagctcccctcggcttccccgggcttgtgcctcaacctcgcctccgaccacgggccgttcgccatccaccacgtcaggctctacgtcgacggcgtcgaggtctcgcacccggagctctacaacgacgggcgctacgtcgtgcacggcctccacggcttcctgccgccgctctcccacggctcgtgctcccacggctcgaatcatcgccaccactaccactaccagtaccaccaccaccaccaccacatcatcgccagttcggccgcgtcgtccgccgcgaccgccgcctccgtggtgcgcatcatgatccgggaggccatcgcccgcctccgcgacagcggctacggcttcgtggcgctggccatgcgcgtcaagttcgccgagctcgagaggttggcgaacatgacggtgttcgcgctcgacgaccaggcaatcttcgtcggcggaggccacgactacgtctcggcggtccgcttccacgtcgtccccgggcaccgcctcacccacgccgacctccagcgcctccacccgggcacgatgctccccacgctggccggcgagggccagaacctcgtcgtcacccagggcgcgtccggctccggctccggccccagagacgtgcgcatcaactacatccccatcaaggaccccgacgtggtgatcaactcgcgcatcgccttgcacggcgtctacgtgacgttcccgcgcctccacctcgccaacctcgccgccgcggtcgccctcgcctcctccaaccagatcaacgcaacctgcggcgtcttcggcgactgcgcctccgccgcggcgacctctaccactgttccggctgctcaccgctacggcgaagggcagtga</cdnaseq>|
 
AA = <aaseq>MALLFRISLLLLLVPLIPTAAASHHHSPAGGGGAAVPLHPRRHH                    RSVANTATALFYPAPSMHQNHIEAEEGQLLHVLADPFAAAPAAAEAPSGETAIAAVGA                    AAEEATPTLIDDSPQQAAAASPPPPPPPPPPPPPLFAKPDLDSTAPPQPKEEGVDGYG                    STTATATVTAAPPLDEPAAATATTTTTTTTTLPLPRYSHVASPPPPPVHAGVAGLGDE                    QRLEQLARVLSSLGYNEMASAALLLANSALLAAWPGSITVFAAPDVFLRASCPMCSRR                    HVLLEHIALGYFPYTELAAASTAKLPSASPGLCLNLASDHGPFAIHHVRLYVDGVEVS                    HPELYNDGRYVVHGLHGFLPPLSHGSCSHGSNHRHHYHYQYHHHHHHIIASSAASSAA                    TAASVVRIMIREAIARLRDSGYGFVALAMRVKFAELERLANMTVFALDDQAIFVGGGH                    DYVSAVRFHVVPGHRLTHADLQRLHPGTMLPTLAGEGQNLVVTQGASGSGSGPRDVRI                    NYIPIKDPDVVINSRIALHGVYVTFPRLHLANLAAAVALASSNQINATCGVFGDCASA                    AATSTTVPAAHRYGEGQ</aaseq>|
 
DNA = <dnaseqindica>56..1807#gtcttcctctccccaagccattcggcaaaagctctctcgagggaagcgcgcatccatggcgctcctcttccgcatctcgctcctcctcctcctcgtcccactcatccccaccgccgccgcgtcccaccaccactcgccggcgggaggaggaggagcggcggtgccgcttcacccgcgccgccaccaccgctccgtcgcgaacacggccacggcgctgttctaccccgccccttccatgcaccagaaccacatcgaggcggaggagggccagttgctgcacgtgctcgccgaccccttcgccgccgcgcccgccgctgccgaggctccgtccggggagaccgccatcgccgcggtgggagcggcggcggaggaggcgacccctacgctgatcgacgactccccgcagcaagcagcggccgcatcaccaccaccaccaccaccacctcctcctcctcctcctcctctcttcgccaagccggatctggactccacggcgccaccgcagccgaaggaggagggcgtggacgggtacgggtcgacgacggcgacggcgacggtgacagcggctccgccactcgacgaacctgctgcagccacggccacgaccacgaccacgaccacgacgacgcttccgctcccgaggtacagccacgtagcgagccctcctccgcctccagtccacgccggggtcgcgggcttgggcgacgagcagcgcctggagcagctggcgagggtgctctcctcgctggggtacaacgagatggcctcggcggcgctgctcctcgccaactcggcgttgctcgcggcgtggccagggtcgatcaccgtcttcgcggctcccgacgtcttcctccgcgcctcttgccccatgtgctcgcgccgccatgtcctactggagcacatcgccctgggctacttcccctacaccgagctcgccgccgcctccaccgccaagctcccctcggcttccccgggcttgtgcctcaacctcgcctccgaccacgggccgttcgccatccaccacgtcaggctctacgtcgacggcgtcgaggtctcgcacccggagctctacaacgacgggcgctacgtcgtgcacggcctccacggcttcctgccgccgctctcccacggctcgtgctcccacggctcgaatcatcgccaccactaccactaccagtaccaccaccaccaccaccacatcatcgccagttcggccgcgtcgtccgccgcgaccgccgcctccgtggtgcgcatcatgatccgggaggccatcgcccgcctccgcgacagcggctacggcttcgtggcgctggccatgcgcgtcaagttcgccgagctcgagaggttggcgaacatgacggtgttcgcgctcgacgaccaggcaatcttcgtcggcggaggccacgactacgtctcggcggtccgcttccacgtcgtccccgggcaccgcctcacccacgccgacctccagcgcctccacccgggcacgatgctccccacgctggccggcgagggccagaacctcgtcgtcacccagggcgcgtccggctccggctccggccccagagacgtgcgcatcaactacatccccatcaaggaccccgacgtggtgatcaactcgcgcatcgccttgcacggcgtctacgtgacgttcccgcgcctccacctcgccaacctcgccgccgcggtcgccctcgcctcctccaaccagatcaacgcaacctgcggcgtcttcggcgactgcgcctccgccgcggcgacctctaccactgttccggctgctcaccgctacggcgaagggcagtgatcgcgtgagtgcgtctctttcgtcctctgcttctaactagctaggatttagcacctgccggttttgtctgtctctgattaggatgagtaatgtgctgtgatgacatatcgtgctactgcctgtacggttctcggttcatgccatggatcagcaactgcttgaaatgaatgagatcttgaaagaattttcagcg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053407.2 RefSeq:Os02g0491300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:07, 14 February 2017

The rice Os02g0491300 was reported as MTR1 in 2012 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0491300 <=> OsMTR1,MTR1
Figure 1. Phenotypic Analysis of mtr1 Anthers.[1].

Function

  • MICROSPORE AND TAPETUM REGULATOR1 (MTR1) is a rice fascilin glycoprotein protein.
  • MTR1 may act as an extracellular adhesion molecule in male reproductive development by regulating the cell-to-cell communication between reproductive cells and their adjacent somatic cells.
  • MTR1 can controll the development of sporophytic and reproductive cells in rice (Oryza sativa).
  • MTR1 is an essential gene for programmed tapetal cell fate and pollen formation in rice.
  • MTR1 is required for both the development of the diploid anther wall cells and maturation of the postmeiotic haploid microspores.
  • MTR1 effect the deposition of sporopollenin precursors on the surface.

Gene Structure

  • MTR1 locus was located on chromosome 2 between two InDel markers, TH239 and TH234. The MTR1 transcript is approximately 2 kb in length and contains a 1,752 bp coding sequence without any intron, a 55 bp 5' untranslated region (UTR) and a 193 bp 3' UTR.
  • The predicted MTR1 protein is 583 amino acids long and contains a putative N-terminal signal peptide; two fasciclin domains (amino acids 257–356 and 435–535); and two potential N-glycosylation sites (amino acids 433 and 554).
Figure 6. Map-Based Cloning analysis of MTR1[1].

Mutation and Phenotype

  • mtr1 shows normal vegetative and nonreproductive floral organ development, but has smaller and pale-yellow anthers that fail to produce viable pollen grains (Figures S1A–S1F available online; Figures 1A and 1B).
  • All the F1 progeny from the backcross between wild-type and mtr1 displayed the wide-type phenotype, and the F 2 progeny yielded a segregation of 481 wild-type and 147 mutant plants (c 2 = 0.85,p > 0.05), suggesting a monofactorial recessive inheritance of the mutation.
  • To characterize the defects of anther development in mtr1, researchers performed 4 0 ,6-diamidino-2-phenylindole (DAPI) staining of microspores.
  1. At stage 8b of anther development, mtr1 produced normal tetrads just like the wild-type (Figures 1C and 1D). However, at stages 9 and 10, after the microspores were released from the tetrad, mtr1 microspores expanded much more slowly than those of the wild-type (Figures 1E–1H).
  2. At later stages, each wild-type microspore underwent mitosis, gener- ating the mature trinucleate pollen grain that contains two smaller sperm nuclei and a larger vegetative nucleus (Figures 1I and 1K).
  3. By contrast, mtr1 microspores continued to show slow development, did not seem to go through mitosis, and were eventually aborted (Figures 1J and 1L).

Labs working on this gene

  • State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology Center, Key Laboratory of Genetics & Development and
  • Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, MI 48824, USA

References

  1. 1.0 1.1 1.2 Tan H, Liang W, Hu J, Zhang D. MTR1 encodes a secretory fasciclin glycoprotein required for male reproductive development in rice. Dev Cell. 2012 Jun 12;22(6):1127-37. doi: 10.1016/j.devcel.2012.04.011. PubMed PMID: 22698279.

Structured Information