Difference between revisions of "Os02g0110200"

From RiceWiki
Jump to: navigation, search
(Evolution)
 
(19 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
 
  
 +
The rice OsHPL3 gene is also known as CYP74B2 and similar to Hydroperoxide lyase.
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0110200''''' '''''<=>''''' '''''OsHPL3,ABCB14,CYP74B2'''''
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsHPL3''''' is a hydroperoxide lyase gene. GLV,the product of OsHPL3,play an important role in the flee resistance to WBPH.  
OsHPL3 is a hydroperoxide lyase gene.Expression levels of OsHPL3 could be significantly enhanced by mechanical wounding,SSB,BPH and WBPH infestation, whereas exogenous hormones JA and SA treatment had no significant effect. GLV,the product of OsHPL3,play an important role in the flee resistance to WBPH. OsHPL3 encodes a lipid hydroperoxide lyase, CYP74B2, which mediates plant specific defense responses.
+
* OsHPL3 encodes a lipid hydroperoxide lyase, CYP74B2, which mediates plant specific defense responses.
The loss-of-function mutant hpl3-1 produced disease-resembling lesions spreading through the whole leaves. A biochemical assay revealed that OsHPL3 possesses intrinsic HPL activity, hydrolyzing hydroperoxylinolenic acid to produce GLVs. OsHPL3 positively modulates resistance to the rice brown planthopper, but negatively modulates resistance to the rice striped stem borer. OsHPL3, by affecting the levels of JA, GLVs and other volatiles, modulates rice-specific defense responses against different invaders. OsHPL3 positively modulates the production of GLVs but negatively affects other volatiles and TrypPI activity as well as JA biosynthesis through substrate competition. OsHPL3 acts as a negative regulator of plant resistance to the chewing herbivore SSB, but a positive regulator of defense against the phloem feeder BPH. OsHPL3 also functions in indirect resistance to BPH through attractiveness to Anagrus nilaparvatae, an egg parasitoid of BPH. We propose that OsHPL3 modulates rice direct and indirect defense responses by affecting the levels of JA and GLVs.
+
* In addition, OsHPL3 plays an important role in normal rice growth and development. [1-4]
OsHPL3 shares limited homology with other HPLs, including OsHPL1, OsHPL2 and an Arabidopsis HPL that modulates biosynthesis of GLVs and JA in Arabidopsis and tobacco.  OsHPL3 has intrinsic HPL activity, metabolizing hydroperoxylinolenic acid to produce GLVs in planta. Loss of OsHPL3function results in increased resistance to the chewing herbivore SSB but enhanced susceptibility to the phloem-feeding herbivore BPH. Interestingly, thehpl3-1plants also exhibited increased attractiveness to the BPH parasitoid A. nilaparvatae. These data strongly suggest that, as an HPL, OsHPL3 is an important player in modulating rice direct and indirect defense responses specifically against different invaders by modulating the oxylipin pathway.
+
* OsHPL3 transcripts are known to be upregulated in response to wounding[2], suggesting that OsHPL3 plays an important role in wound signaling. OsHPL3 is wound-inducible and exclusively expressed in leaves. In contrast, OsHPL1 and OsHPL2 are not wound induced.
OsHPL3 is wound-inducible and exclusively expressed in leaves. In contrast, OsHPL1 and OsHPL2are not wound induced. OsHPL3 is the major wound-induced HPL in rice leaves. Interestingly, mutation in OsHPL3 also creates plants with enhanced resistance to bacterial blight and enhanced expression of PR genes.
+
* OsHPL3 is the major wound-induced HPL in rice leaves. Interestingly, mutation in OsHPL3 also creates plants with enhanced resistance to bacterial blight and enhanced expression of PR genes[1].
 +
 
 +
===Phenotypic analysis===
 +
* The loss-of-function mutant hpl3-1 produced disease-resembling lesions spreading through the whole leaves. A biochemical assay revealed that OsHPL3 possesses intrinsic HPL activity, hydrolyzing hydroperoxylinolenic acid to produce GLVs. OsHPL3 positively modulates resistance to the rice brown planthopper, but negatively modulates resistance to the rice striped stem borer. OsHPL3, by affecting the levels of JA, GLVs and other volatiles, modulates rice-specific defense responses against different invaders. OsHPL3 positively modulates the production of GLVs but negatively affects other volatiles and TrypPI activity as well as JA biosynthesis through substrate competition. OsHPL3 acts as a negative regulator of plant resistance to the chewing herbivore SSB, but a positive regulator of defense against the phloem feeder BPH. OsHPL3 also functions in indirect resistance to BPH through attractiveness to Anagrus nilaparvatae, an egg parasitoid of BPH. We propose that OsHPL3 modulates rice direct and indirect defense responses by affecting the levels of JA and GLVs. [1]
  
 
===Expression===
 
===Expression===
 
+
* Expression levels of OsHPL3 could be significantly enhanced by mechanical wounding,SSB,BPH and WBPH infestation, whereas exogenous hormones JA and SA treatment had no significant effect.
Sequencing the candidates revealed that Os02g0110200, which encodes an HPL (OsHPL3, accession number AY340220) with 487 amino acids, was disrupted by insertion of a transposon-like element of approximately 700 bp between nucleotides 518 and 519. The insertion probably results in loss of Os02g0110200 functions, as its transcripts and encoded products were undetectable inhpl3-1. Furthermore, a complementation construct containing the WT OsHPL3genomic region with its own promoter complemented thehpl3-1 phenotypes, confirming that the mutation in OsHPL3 is responsible for the mutant phenotypes.
 
  
 
===Evolution===
 
===Evolution===
 
+
* OsHPL3 shares limited homology with other HPLs, including OsHPL1, OsHPL2 and an Arabidopsis HPL that modulates biosynthesis of GLVs and JA in Arabidopsis and tobacco. 
The rice OsHPL3 gene is also known as CYP74B2 and similar to Hydroperoxide lyase.
+
* OsHPL3 has intrinsic HPL activity, metabolizing hydroperoxylinolenic acid to produce GLVs in planta. Loss of OsHPL3function results in increased resistance to the chewing herbivore SSB but enhanced susceptibility to the phloem-feeding herbivore BPH. Interestingly, thehpl3-1plants also exhibited increased attractiveness to the BPH parasitoid A. nilaparvatae.  
Search for the theme “OsHPL3” on web of science. The total is four related references. And the Citation Report is as follows(Fig3a, Fig3b). It shows that the study of OsHPL3 gene was started at the year of 2006. And the study is sustainable development and rises sharply in recent two years.
+
* These data strongly suggest that, as an HPL, OsHPL3 is an important player in modulating rice direct and indirect defense responses specifically against different invaders by modulating the oxylipin pathway. [1]
 
 
  (June 2, 2014)
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*1, State Key Laboratory of Plant Genomics, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, People’s Republic of China
1, State Key Laboratory of Plant Genomics, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, People’s Republic of China
+
*2, College of Agriculture and Biotechnology, Zhejiang University, Hangzhou 310029, China,
2, College of Agriculture and Biotechnology, Zhejiang University, Hangzhou 310029, China,
+
*3, National Key Laboratory of Plant Molecular Genetics and National Center of Plant Gene Research, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China,
3, National Key Laboratory of Plant Molecular Genetics and National Center of Plant Gene Research, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China,
+
*4, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 31006, China, and National Engineering Center for BioChip at Shanghai, Shanghai 201203, China
4, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 31006, China, and National Engineering Center for BioChip at Shanghai, Shanghai 201203, China
+
*5, Section of Plant Biology, University of California, Davis, California 95616
5, Section of Plant Biology, University of California, Davis, California 95616
 
  
 
==References==
 
==References==
 
[1] Xiaohong Tong; Jinfeng Qi; Xudong Zhu; Bizeng Mao; Longjun Zeng; Baohui Wang; Qun Li; Guoxin Zhou; Xiaojing Xu; Yonggen Lou; Zuhua He. The rice hydroperoxide lyase OsHPL3 functions in defense responses by modulating the oxylipin pathway. The Plant Journal, 2012, 71(5): 763-775.
 
[1] Xiaohong Tong; Jinfeng Qi; Xudong Zhu; Bizeng Mao; Longjun Zeng; Baohui Wang; Qun Li; Guoxin Zhou; Xiaojing Xu; Yonggen Lou; Zuhua He. The rice hydroperoxide lyase OsHPL3 functions in defense responses by modulating the oxylipin pathway. The Plant Journal, 2012, 71(5): 763-775.
 +
 
[2] E.W. Chehab, G. Raman, J.W. Walley, J.V. Perea, G. Banu, S.Theg, K.Dehesh. Rice HYDROPEROXIDE LYASES with unique expression patterns generate distinct aldehyde signatures in Arabidopsis. Plant Physiology, 2006, 141(1):121-34.
 
[2] E.W. Chehab, G. Raman, J.W. Walley, J.V. Perea, G. Banu, S.Theg, K.Dehesh. Rice HYDROPEROXIDE LYASES with unique expression patterns generate distinct aldehyde signatures in Arabidopsis. Plant Physiology, 2006, 141(1):121-34.
 +
 
[3] Jinfeng Qi, Guoxin Zhou, Lijuan Yang, Matthias Erb, Yanhua Lu, Xiaoling Sun, Jiaan Cheng, and Yonggen Lou. The Chloroplast-Localized Phospholipases Da4anda5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice. Plant Physiology, 2011, 157(4):1987-99.
 
[3] Jinfeng Qi, Guoxin Zhou, Lijuan Yang, Matthias Erb, Yanhua Lu, Xiaoling Sun, Jiaan Cheng, and Yonggen Lou. The Chloroplast-Localized Phospholipases Da4anda5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice. Plant Physiology, 2011, 157(4):1987-99.
 +
 
[4] Xiaoqiang Liu, Feng Li, Jiuyou Tang, Weihong Wang, Fengxia Zhang, Guodong Wang, Jinfang Chu, Cunyu Yan, Taoqing Wang, Chengcai Chu*, Chuanyou Li*. Activation of the Jasmonic Acid Pathway by Depletion of the Hydroperoxide Lyase OsHPL3 Reveals Crosstalk between the HPL and AOS Branches of the Oxylipin Pathway in Rice. PLoS One. 2012;7(11):e50089. doi: 10.1371/journal.pone.0050089. Epub 2012 Nov 29.
 
[4] Xiaoqiang Liu, Feng Li, Jiuyou Tang, Weihong Wang, Fengxia Zhang, Guodong Wang, Jinfang Chu, Cunyu Yan, Taoqing Wang, Chengcai Chu*, Chuanyou Li*. Activation of the Jasmonic Acid Pathway by Depletion of the Hydroperoxide Lyase OsHPL3 Reveals Crosstalk between the HPL and AOS Branches of the Oxylipin Pathway in Rice. PLoS One. 2012;7(11):e50089. doi: 10.1371/journal.pone.0050089. Epub 2012 Nov 29.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0110200|
 
Description = Similar to Hydroperoxide lyase|
 
Version = NM_001052183.1 GI:115443736 GeneID:4328040|
 
Length = 1742 bp|
 
Definition = Oryza sativa Japonica Group Os02g0110200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:554579..556320|
 
CDS = 554635..556098|
 
GCID = <gbrowseImage1>
 
name=NC_008395:554579..556320
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:554579..556320
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggtgccgtcgttcccgcagccggccagtgcggcggcggcgacgcggccaataccggggagctacggcccgccgctgctcggcccgctccgcgaccgcctcgactacttctggttccagggccccgacgacttcttccgccgccgcgccgccgaccacaagagcaccgtgttccgcgccaacatcccgcccaccttccccttcttcctcggcgtcgacccgcgcgtcgtcgccgtcgttgatgccgccgccttcaccgcgctcttcgacccggccctcgtcgacaagcgcgacgtcctcatcggcccctacgtccccagcctcgccttcacccgcggcacccgcgtcggcgtctacctcgacacccaggaccccgaccacgcccgcaccaaggccttctccatcgacctcctccgccgcgccgcccgcaactgggccgccgagctccgcgccgccgtcgacgacatgctcgccgccgtcgaggaagacctcaacagggcccctgaccccgccgccgcctccgccagctacctcatcccgctccagaagtgcatcttccgcttcctctgcaaggcgctcgtcggcgccgacccggcggcggacggcctcgtcgaccgcttcggcgtgtacatcctcgacgtgtggctggcgttgcagctggtgccgacgcagaaggtgggcgtcatcccgcagccgctggaggagctcctgctccactccttcccgctgccgtcgttcgtcgtcaagcccgggtacgacctcctctaccgcttcgtggagaagcacggcgccgccgccgtgtccatcgctgagaaggagcacggcatcagcaaggaggaggccatcaacaacatcctcttcgtgctcggcttcaacgcgttcggcggcttctcggtgttcctgccgttcctggtcatggaggtcggcaagcccggccgggacgacctgcggcggcggctgcgggaggaggtgcgccgcgtgctgggcggcggcgacggcggcgaggccgggttcgcggcggtgagggagatggcgctggtgcggtcgacggtgtacgaggtgctccggatgcagccgccggtgccgctgcagttcgggcgggcgcggcgagacttcgtgctgcggtcgcacggcggcgcggcgtacgaggtgggcaagggcgagctgctgtgcgggtaccagccgctggccatgcgcgacccggcggtgttcgaccggccggaggagttcgtgccggagaggttcctcggcgacgacggcgaggcgctgctgcagtacgtgtactggtccaacgggccggagaccggcgagccgtcgccggggaacaaacagtgtgccgccaaggaggtggtcgtcgccaccgcgtgcatgctcgtcgccgagcttttccggcggtacgacgacttcgaatgcgacggcacctccttcaccaagctcgacaagcgggagctcactcccagctaa</cdnaseq>|
 
AA = <aaseq>MVPSFPQPASAAAATRPIPGSYGPPLLGPLRDRLDYFWFQGPDD                    FFRRRAADHKSTVFRANIPPTFPFFLGVDPRVVAVVDAAAFTALFDPALVDKRDVLIG                    PYVPSLAFTRGTRVGVYLDTQDPDHARTKAFSIDLLRRAARNWAAELRAAVDDMLAAV                    EEDLNRAPDPAAASASYLIPLQKCIFRFLCKALVGADPAADGLVDRFGVYILDVWLAL                    QLVPTQKVGVIPQPLEELLLHSFPLPSFVVKPGYDLLYRFVEKHGAAAVSIAEKEHGI                    SKEEAINNILFVLGFNAFGGFSVFLPFLVMEVGKPGRDDLRRRLREEVRRVLGGGDGG                    EAGFAAVREMALVRSTVYEVLRMQPPVPLQFGRARRDFVLRSHGGAAYEVGKGELLCG                    YQPLAMRDPAVFDRPEEFVPERFLGDDGEALLQYVYWSNGPETGEPSPGNKQCAAKEV                    VVATACMLVAELFRRYDDFECDGTSFTKLDKRELTPS</aaseq>|
 
DNA = <dnaseqindica>57..1520#ataacgcaagctaccacacgtagctgataagtccgatcgtcgccgcgcgccgcgccatggtgccgtcgttcccgcagccggccagtgcggcggcggcgacgcggccaataccggggagctacggcccgccgctgctcggcccgctccgcgaccgcctcgactacttctggttccagggccccgacgacttcttccgccgccgcgccgccgaccacaagagcaccgtgttccgcgccaacatcccgcccaccttccccttcttcctcggcgtcgacccgcgcgtcgtcgccgtcgttgatgccgccgccttcaccgcgctcttcgacccggccctcgtcgacaagcgcgacgtcctcatcggcccctacgtccccagcctcgccttcacccgcggcacccgcgtcggcgtctacctcgacacccaggaccccgaccacgcccgcaccaaggccttctccatcgacctcctccgccgcgccgcccgcaactgggccgccgagctccgcgccgccgtcgacgacatgctcgccgccgtcgaggaagacctcaacagggcccctgaccccgccgccgcctccgccagctacctcatcccgctccagaagtgcatcttccgcttcctctgcaaggcgctcgtcggcgccgacccggcggcggacggcctcgtcgaccgcttcggcgtgtacatcctcgacgtgtggctggcgttgcagctggtgccgacgcagaaggtgggcgtcatcccgcagccgctggaggagctcctgctccactccttcccgctgccgtcgttcgtcgtcaagcccgggtacgacctcctctaccgcttcgtggagaagcacggcgccgccgccgtgtccatcgctgagaaggagcacggcatcagcaaggaggaggccatcaacaacatcctcttcgtgctcggcttcaacgcgttcggcggcttctcggtgttcctgccgttcctggtcatggaggtcggcaagcccggccgggacgacctgcggcggcggctgcgggaggaggtgcgccgcgtgctgggcggcggcgacggcggcgaggccgggttcgcggcggtgagggagatggcgctggtgcggtcgacggtgtacgaggtgctccggatgcagccgccggtgccgctgcagttcgggcgggcgcggcgagacttcgtgctgcggtcgcacggcggcgcggcgtacgaggtgggcaagggcgagctgctgtgcgggtaccagccgctggccatgcgcgacccggcggtgttcgaccggccggaggagttcgtgccggagaggttcctcggcgacgacggcgaggcgctgctgcagtacgtgtactggtccaacgggccggagaccggcgagccgtcgccggggaacaaacagtgtgccgccaaggaggtggtcgtcgccaccgcgtgcatgctcgtcgccgagcttttccggcggtacgacgacttcgaatgcgacggcacctccttcaccaagctcgacaagcgggagctcactcccagctaagctttgctgccgccattctctcactcgatctccatgcacatatgcatgaagaaattaattaaattcaagttgctagctccattttttctctttgagctgctgataaaaaaaacatctctattcttctgtgcaataagccaataattaagcattaatcagagcgtacaagtaaaaattgttttcactgttttatgtggatatatatatgtacagggatccacc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052183.1 RefSeq:Os02g0110200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 09:25, 14 February 2017

The rice OsHPL3 gene is also known as CYP74B2 and similar to Hydroperoxide lyase.

Annotated Information

Gene Symbol

  • Os02g0110200 <=> OsHPL3,ABCB14,CYP74B2

Function

  • OsHPL3 is a hydroperoxide lyase gene. GLV,the product of OsHPL3,play an important role in the flee resistance to WBPH.
  • OsHPL3 encodes a lipid hydroperoxide lyase, CYP74B2, which mediates plant specific defense responses.
  • In addition, OsHPL3 plays an important role in normal rice growth and development. [1-4]
  • OsHPL3 transcripts are known to be upregulated in response to wounding[2], suggesting that OsHPL3 plays an important role in wound signaling. OsHPL3 is wound-inducible and exclusively expressed in leaves. In contrast, OsHPL1 and OsHPL2 are not wound induced.
  • OsHPL3 is the major wound-induced HPL in rice leaves. Interestingly, mutation in OsHPL3 also creates plants with enhanced resistance to bacterial blight and enhanced expression of PR genes[1].

Phenotypic analysis

  • The loss-of-function mutant hpl3-1 produced disease-resembling lesions spreading through the whole leaves. A biochemical assay revealed that OsHPL3 possesses intrinsic HPL activity, hydrolyzing hydroperoxylinolenic acid to produce GLVs. OsHPL3 positively modulates resistance to the rice brown planthopper, but negatively modulates resistance to the rice striped stem borer. OsHPL3, by affecting the levels of JA, GLVs and other volatiles, modulates rice-specific defense responses against different invaders. OsHPL3 positively modulates the production of GLVs but negatively affects other volatiles and TrypPI activity as well as JA biosynthesis through substrate competition. OsHPL3 acts as a negative regulator of plant resistance to the chewing herbivore SSB, but a positive regulator of defense against the phloem feeder BPH. OsHPL3 also functions in indirect resistance to BPH through attractiveness to Anagrus nilaparvatae, an egg parasitoid of BPH. We propose that OsHPL3 modulates rice direct and indirect defense responses by affecting the levels of JA and GLVs. [1]

Expression

  • Expression levels of OsHPL3 could be significantly enhanced by mechanical wounding,SSB,BPH and WBPH infestation, whereas exogenous hormones JA and SA treatment had no significant effect.

Evolution

  • OsHPL3 shares limited homology with other HPLs, including OsHPL1, OsHPL2 and an Arabidopsis HPL that modulates biosynthesis of GLVs and JA in Arabidopsis and tobacco.
  • OsHPL3 has intrinsic HPL activity, metabolizing hydroperoxylinolenic acid to produce GLVs in planta. Loss of OsHPL3function results in increased resistance to the chewing herbivore SSB but enhanced susceptibility to the phloem-feeding herbivore BPH. Interestingly, thehpl3-1plants also exhibited increased attractiveness to the BPH parasitoid A. nilaparvatae.
  • These data strongly suggest that, as an HPL, OsHPL3 is an important player in modulating rice direct and indirect defense responses specifically against different invaders by modulating the oxylipin pathway. [1]

Labs working on this gene

  • 1, State Key Laboratory of Plant Genomics, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing, People’s Republic of China
  • 2, College of Agriculture and Biotechnology, Zhejiang University, Hangzhou 310029, China,
  • 3, National Key Laboratory of Plant Molecular Genetics and National Center of Plant Gene Research, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China,
  • 4, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 31006, China, and National Engineering Center for BioChip at Shanghai, Shanghai 201203, China
  • 5, Section of Plant Biology, University of California, Davis, California 95616

References

[1] Xiaohong Tong; Jinfeng Qi; Xudong Zhu; Bizeng Mao; Longjun Zeng; Baohui Wang; Qun Li; Guoxin Zhou; Xiaojing Xu; Yonggen Lou; Zuhua He. The rice hydroperoxide lyase OsHPL3 functions in defense responses by modulating the oxylipin pathway. The Plant Journal, 2012, 71(5): 763-775.

[2] E.W. Chehab, G. Raman, J.W. Walley, J.V. Perea, G. Banu, S.Theg, K.Dehesh. Rice HYDROPEROXIDE LYASES with unique expression patterns generate distinct aldehyde signatures in Arabidopsis. Plant Physiology, 2006, 141(1):121-34.

[3] Jinfeng Qi, Guoxin Zhou, Lijuan Yang, Matthias Erb, Yanhua Lu, Xiaoling Sun, Jiaan Cheng, and Yonggen Lou. The Chloroplast-Localized Phospholipases Da4anda5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice. Plant Physiology, 2011, 157(4):1987-99.

[4] Xiaoqiang Liu, Feng Li, Jiuyou Tang, Weihong Wang, Fengxia Zhang, Guodong Wang, Jinfang Chu, Cunyu Yan, Taoqing Wang, Chengcai Chu*, Chuanyou Li*. Activation of the Jasmonic Acid Pathway by Depletion of the Hydroperoxide Lyase OsHPL3 Reveals Crosstalk between the HPL and AOS Branches of the Oxylipin Pathway in Rice. PLoS One. 2012;7(11):e50089. doi: 10.1371/journal.pone.0050089. Epub 2012 Nov 29.

Structured Information