Difference between revisions of "Os01g0869200"

From RiceWiki
Jump to: navigation, search
m
 
(8 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0869200''''' was reported as '''''OsABCC1''''' in 2014 <ref name="ref1" /> by researchers from Korea and Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Example1234567.jpg|right|thumb|327px|'''Figure 1.''' ''Expression pattern of OsMGT1 in rice.<ref name="ref1" />.'']]
 
===Function===
 
===Function===
  OsMGT1 is a transporter for Mg uptake in the roots and that up-regulation of this gene is required for conferring Al tolerance in rice by increasing Mg concentration in the cell.
+
* Up-Regulation of a Magnesium Transporter Gene '''''OsMGT1''''' Is Required for Conferring Aluminum Tolerance in Rice.
 +
* '''''OsMGT1''''' is a transporter for Mg uptake in the roots and that up-regulation of this gene is required for conferring Al tolerance in rice by increasing Mg concentration in the cell.
 +
 
 +
===Phenotypic analysis===
 +
* When a putative rice (Oryza sativa) Mg transporter gene, Oryza sativa MAGNESIUM TRANSPORTER1 (OsMGT1), was knocked out, the tolerance to Al, but not to cadmium and lanthanum, was decreased.
 +
* However, this inhibition could be rescued by addition of 10 m M Mg, but not by the same concentration of barium or strontium.
  
 
===Expression===
 
===Expression===
 
+
* Real-time reverse transcription (RT)-PCR analysis revealed that OsMGT1 was expressed in both the shoots and roots at similar level in the absence of Al.  
 
+
* However, in the presence of Al, the expression in the roots was up-regulated by 5 times, but that in the shoots was unaffected.  
1 Sequence Analysis of OsMGT1 in Rice
+
* Root spatial analysis showed that OsMGT1 was expressed in both the root tips (0–1 cm) and mature region (1–2 cm) and the expression in both regions were up-regulated by Al.  
 
+
* However, in art1 (a mutant defective in the Al response C2H2-type zinc-finger transcription factor), the Al-induced expression was not observed , confirming that OsMGT1 expression was regulated by ART1.
OsMGT1 (Os01g0869200) cloned from rice (cv Nipponbare) contains six exons and five introns (Supplemental Fig. S1A), encoding a peptide of 418 amino acids. Using the SOSUI program (http://bp.nuap.nagoya-u.ac.jp/sosui/), it has been predicted that OsMGT1 is a membrane protein with two transmembrane domains near the C terminus (Supplemental Fig. S1B). OsMGT1 showed the similarity ranging from 63% to 81% to Arabidopsis Mg transporter AtMGT family at the amino acid level. Like other Arabidopsis members, there is a conserved Gly-Met-Asn tripeptide motif at the end of the first transmembrane  (domain.http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/bin/PP_199778_LW_f1.gif)
 
  
2 Expression Pattern of OsMGT1
+
===Sequence Analysis ===
 +
* OsMGT1 (Os01g0869200) cloned from rice (cv Nipponbare) contains six exons and five introns, encoding a peptide of 418 amino acids.
 +
*  Using the SOSUI program (http://bp.nuap.nagoya-u.ac.jp/sosui/), it has been predicted that OsMGT1 is a membrane protein with two transmembrane domains near the C terminus.
 +
* OsMGT1 showed the similarity ranging from 63% to 81% to Arabidopsis Mg transporter AtMGT family at the amino acid level. Like other Arabidopsis members, there is a conserved Gly-Met-Asn tripeptide motif at the end of the first transmembrane.
  
Real-time reverse transcription (RT)-PCR analysis revealed that OsMGT1 was expressed in both the shoots and roots at similar level in the absence of Al . However, in the presence of Al, the expression in the roots was up-regulated by 5 times, but that in the shoots was unaffected. Root spatial analysis showed that OsMGT1 was expressed in both the root tips (0–1 cm) and mature region (1–2 cm) and the expression in both regions were up-regulated by Al. However, in art1 (a mutant defective in the Al response C2H2-type zinc-finger transcription factor), the Al-induced expression was not observed , confirming that OsMGT1 expression was regulated by ART1.(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/figure/fig2/)
+
===Sub-cellular Localization of OsMGT1===
 +
[[File:222-Os01g0869200.jpg|right|thumb|327px|'''Figure 3.''' ''Subcellular localization of OsMGT1.<ref name="ref1" />.'']]
 +
* The subcellular localization of OsMGT1 was investigated in rice protoplasts by transiently expressing '''''OsMGT1''''' fused with GFP at both C terminal and N terminal under the control of 35S promoter.  
 +
* Either construct gave a signal at the plasma membrane , in contrast to GFP alone, which signal was observed in cytosol and nuclei.(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/figure/fig3/)
  
3 Sub-cellular Localization of OsMGT1
 
 
The subcellular localization of OsMGT1 was investigated in rice protoplasts by transiently expressing OsMGT1 fused with GFP at both C terminal and N terminal under the control of 35S promoter. Either construct gave a signal at the plasma membrane , in contrast to GFP alone, which signal was observed in cytosol and nuclei.(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/figure/fig3/)
 
 
 
===Evolution===
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Institute of Plant Science and Resources, Okayama University, Kurashiki 710–0046, Japan (Z.C.C., N.Y., J.F.M.); and Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan (R.M., Y.N.)
 
Institute of Plant Science and Resources, Okayama University, Kurashiki 710–0046, Japan (Z.C.C., N.Y., J.F.M.); and Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan (R.M., Y.N.)
Line 31: Line 35:
 
   Plant Physiology, 2012, 159(4): 1624-1633
 
   Plant Physiology, 2012, 159(4): 1624-1633
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0869200|
 
Description = Mg2+ transporter protein, CorA-like family protein|
 
Version = NM_001051459.1 GI:115441288 GeneID:4324927|
 
Length = 3103 bp|
 
Definition = Oryza sativa Japonica Group Os01g0869200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:39420080..39423182|
 
CDS = 39420113..39420466,39420663..39420842,39421291..39421419,39421524..39421672,39421833..39421971<br>,39422557..39422862|
 
GCID = <gbrowseImage1>
 
name=NC_008394:39420080..39423182
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:39420080..39423182
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagcggagggcgcagccggtgtcggcggcggtggcgccggtgacggggaggaggaagggtgcggcggcgagccggaagtggatggtggtgccggcggtgggggaggagcggagggtggagtttgggaagcaccagatcatgaagatgacggggctccccgggcgcgacctccgggtgctcgacccggtcctctcctacccgtccaccatcctcggccgcgaccgcgccatcgtcgtcaggctccagggcgtcaaggccatcatcaccgccaccgaggtgctcgtccccgaccacgacgacgtcctcctcgcctccttcctcctcgacctccgctcccgcctctccctcccggatgcggcgcctagcacgaatccggcggcggctgatcgcgggaacgggacggagcagggcgatcaggggagcgtgccaggtctggcgatcagcggtgctggcaacgccaagatcccgccctttgagttcaaggtgctcgaggtctgcctcgagcacgcatgcaaagacttggaatctcagacacgctctctggagaaggaggcgtatccggccttggacaagctgggatcgaaggttagcacgctgaacctggatcacgtcaggaatctgaagagccgcatggttgatctctcagggcgcgtgcagaagattagggatgagctggagcacttgctggatgacgacatggacatgtccgagatgtacctgacgaggaagctgtcgttccaagggctcagcggatcgctgagcagagcggattcacacaagtacgcatctgttgatcatgacgacgatagggaggaggaagaccatgacgatgagacagagagtggccgtgaaagttctgtttatgttaagcctgatatagaagagttggaaatgcttctggaagcttactttgtgcagatcgatggaacgctgaataccctgtaccatatccgtgaatacgcggacgacacggaggattacatcaacataatgctggacgagaagcagaaccagctgctgcagatgggcgtgatgctgacgacggcgacggtggtggtcaccgcgggcatcgtggtggtgagcctgttcggcatgaacatccacatcgacctgatgaaagacccggagacccccgagatggtgaggatgtccaacatgcacttttgggagaccaccttcggcacggtcgccggctgcatcgccatatacctcctggcgatctacgctgggaggaagagcaagatcctgcagtga</cdnaseq>|
 
AA = <aaseq>MERRAQPVSAAVAPVTGRRKGAAASRKWMVVPAVGEERRVEFGK                    HQIMKMTGLPGRDLRVLDPVLSYPSTILGRDRAIVVRLQGVKAIITATEVLVPDHDDV                    LLASFLLDLRSRLSLPDAAPSTNPAAADRGNGTEQGDQGSVPGLAISGAGNAKIPPFE                    FKVLEVCLEHACKDLESQTRSLEKEAYPALDKLGSKVSTLNLDHVRNLKSRMVDLSGR                    VQKIRDELEHLLDDDMDMSEMYLTRKLSFQGLSGSLSRADSHKYASVDHDDDREEEDH                    DDETESGRESSVYVKPDIEELEMLLEAYFVQIDGTLNTLYHIREYADDTEDYINIMLD                    EKQNQLLQMGVMLTTATVVVTAGIVVVSLFGMNIHIDLMKDPETPEMVRMSNMHFWET                    TFGTVAGCIAIYLLAIYAGRKSKILQ</aaseq>|
 
DNA = <dnaseqindica>34..387#584..763#1212..1340#1445..1593#1754..1892#2478..2783#agccgccaccggggtcaccaccatcgagctcgtatggagcggagggcgcagccggtgtcggcggcggtggcgccggtgacggggaggaggaagggtgcggcggcgagccggaagtggatggtggtgccggcggtgggggaggagcggagggtggagtttgggaagcaccagatcatgaagatgacggggctccccgggcgcgacctccgggtgctcgacccggtcctctcctacccgtccaccatcctcggccgcgaccgcgccatcgtcgtcaggctccagggcgtcaaggccatcatcaccgccaccgaggtgctcgtccccgaccacgacgacgtcctcctcgcctccttcctcctcgacctccgctcccgcctctccctcccggttggtacaccgtacaccatctctttttctcttctgttttctcatcatcaccacatccaggttcactctgttgcattggttgtactagcagattgcatctgcaaactgatatgacattgaactctggaatttgattctgttatcgtcgtcgtgattgactctactgaaactctgatgatgattattctgggtgaaggatgcggcgcctagcacgaatccggcggcggctgatcgcgggaacgggacggagcagggcgatcaggggagcgtgccaggtctggcgatcagcggtgctggcaacgccaagatcccgccctttgagttcaaggtgctcgaggtctgcctcgagcacgcatgcaaagacttggaatctcaggtatactgccagaaaatttgtctattgctgctgatgatgaatcaaaccaatggtagtatatattaagggggtgtttagatctagaggtataaagttttggcgtgtcatttcgggcattatatatggtgtcgtatagggtattcggatactaataaaaaaattaattacataatccatcattaaaccgcaaaacgaatttattaagcataattaatccatcattagcaaatgtttactatagcaccacattgtcaaatcatggagcaattaggcttaaaagattcgtctcgtaaattagtcgcaatctgtgcaattagttattttttaacctatattaaatacttcatacatgtattcaaacgttcgatgtgacagggtgaaaaattttgaggtgtgatctaaacagggcctaattcatgttcatctctgtctctgcaaatggtgtcagacacgctctctggagaaggaggcgtatccggccttggacaagctgggatcgaaggttagcacgctgaacctggatcacgtcaggaatctgaagagccgcatggttgatctctcagggcgcgtgcagaaggtacgcaagaacagtggactccgttcgcttgagtccgtttaagttgcagctgaaagcgatggcacctaagcattttggccacctgttcttggtctcgcatgcagattagggatgagctggagcacttgctggatgacgacatggacatgtccgagatgtacctgacgaggaagctgtcgttccaagggctcagcggatcgctgagcagagcggattcacacaagtacgcatctgttgatcatgacgacgataggtatgtcacctgaattttgttctttctggtttttggcaggatcgaaagactcgaagtaggagttgttacctgaattctttaaccggaaatggatgttgattgttgatagattgccgatccgtggcttttgttttaatctttcatttgcgcctgtattcagggaggaggaagaccatgacgatgagacagagagtggccgtgaaagttctgtttatgttaagcctgatatagaagagttggaaatgcttctggaagcttactttgtgcagatcgatggaacgctgaataccctgtaccatgtatgttcatcctcctcctttactaagggcttcatcttttgcctataataaatcagccattgccaaattttaatataaaagttaattttagagtttattttgggcacttttaacatagtttcttttttagcaatagcttttaaatcactaaaaacacgcatctaaaagtttcacctacaaactattttttggttgctttgttttatacattttttagttgctaataagctgttatggtttataatcagctctcggtcaactgatgaagttgaacattgccatgcttagattgttactgaaatggttgtcatgctaatatcaactgttttagtacaatttagtgatactgtccagtttggaagataaacatgcgatatttagcataacttctgtaaaagtctctgcagccaaaatctgacgaaatcttgttaatgtttgccattgaaatcgacactggttttatcaaacagttaaaatgtatagcctgcattgtcacgcacttgcatcgctcactactagcaaattccatgcattgcttgatgtttcattgcccccctgacatttgcctattgacatggaacaaagatccgtgaatacgcggacgacacggaggattacatcaacataatgctggacgagaagcagaaccagctgctgcagatgggcgtgatgctgacgacggcgacggtggtggtcaccgcgggcatcgtggtggtgagcctgttcggcatgaacatccacatcgacctgatgaaagacccggagacccccgagatggtgaggatgtccaacatgcacttttgggagaccaccttcggcacggtcgccggctgcatcgccatatacctcctggcgatctacgctgggaggaagagcaagatcctgcagtgatgcttcccaacagaggaagctaagcgtcaggttgcgagttctgcagcctggctgcgattttgctgggcagtggcgtagttgataggttgtgtatggatgtgatgcatttttgttgatttcgtatggtgtgggagcaataataatcgaacgatctctctccatttcctgctcttattagaagttagcacttagcactactatgttaaatttcggccaaaggaaccactatgttaaatttcggccaaaggaaccctttcagaaatgctcttgccacatttcgcattcgaagtaaatccaaaaaaggtaccagtaattctcat</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051459.1 RefSeq:Os01g0869200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 09:46, 14 February 2017

The rice Os01g0869200 was reported as OsABCC1 in 2014 [1] by researchers from Korea and Japan.

Annotated Information

Figure 1. Expression pattern of OsMGT1 in rice.[1].

Function

  • Up-Regulation of a Magnesium Transporter Gene OsMGT1 Is Required for Conferring Aluminum Tolerance in Rice.
  • OsMGT1 is a transporter for Mg uptake in the roots and that up-regulation of this gene is required for conferring Al tolerance in rice by increasing Mg concentration in the cell.

Phenotypic analysis

  • When a putative rice (Oryza sativa) Mg transporter gene, Oryza sativa MAGNESIUM TRANSPORTER1 (OsMGT1), was knocked out, the tolerance to Al, but not to cadmium and lanthanum, was decreased.
  • However, this inhibition could be rescued by addition of 10 m M Mg, but not by the same concentration of barium or strontium.

Expression

  • Real-time reverse transcription (RT)-PCR analysis revealed that OsMGT1 was expressed in both the shoots and roots at similar level in the absence of Al.
  • However, in the presence of Al, the expression in the roots was up-regulated by 5 times, but that in the shoots was unaffected.
  • Root spatial analysis showed that OsMGT1 was expressed in both the root tips (0–1 cm) and mature region (1–2 cm) and the expression in both regions were up-regulated by Al.
  • However, in art1 (a mutant defective in the Al response C2H2-type zinc-finger transcription factor), the Al-induced expression was not observed , confirming that OsMGT1 expression was regulated by ART1.

Sequence Analysis

  • OsMGT1 (Os01g0869200) cloned from rice (cv Nipponbare) contains six exons and five introns, encoding a peptide of 418 amino acids.
  • Using the SOSUI program (http://bp.nuap.nagoya-u.ac.jp/sosui/), it has been predicted that OsMGT1 is a membrane protein with two transmembrane domains near the C terminus.
  • OsMGT1 showed the similarity ranging from 63% to 81% to Arabidopsis Mg transporter AtMGT family at the amino acid level. Like other Arabidopsis members, there is a conserved Gly-Met-Asn tripeptide motif at the end of the first transmembrane.

Sub-cellular Localization of OsMGT1

File:222-Os01g0869200.jpg
Figure 3. Subcellular localization of OsMGT1.[1].
  • The subcellular localization of OsMGT1 was investigated in rice protoplasts by transiently expressing OsMGT1 fused with GFP at both C terminal and N terminal under the control of 35S promoter.
  • Either construct gave a signal at the plasma membrane , in contrast to GFP alone, which signal was observed in cytosol and nuclei.(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/figure/fig3/)

Labs working on this gene

Institute of Plant Science and Resources, Okayama University, Kurashiki 710–0046, Japan (Z.C.C., N.Y., J.F.M.); and Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan (R.M., Y.N.)

References

1. Zhi Chang Chen;Naoki Yamaji;Ritsuko Motoyama;Yoshiaki Nagamura;Jian Feng Ma

 Up-Regulation of a Magnesium Transporter Gene OsMGT1 Is Required for Conferring Aluminum Tolerance in Rice
 Plant Physiology, 2012, 159(4): 1624-1633

Structured Information

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1