Difference between revisions of "Os01g0510100"

From RiceWiki
Jump to: navigation, search
(Evolution)
 
(4 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice gene Os01g0510100 was reported as '''''OsMKK6''''' in 2008<ref name="ref1"/>, 2013<ref name="ref2"/><ref name="ref3"/>, 2012<ref name="ref4"/>, '''''OsMEK1''''' in 2006<ref name="ref5"/>, respectively.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File: OsMKK6 phylogenic1.jpg|right|thumb|527px|'''Figure 1.''' ''Phylogenetic relationship between MKKs from indica rice cultivar with the other known MKKs from different plants(from reference <ref name="ref1"/>).'']]
 +
*Under '''UV stress''' ''OsMKK6'' may have role in '''regulation''' of '''biosynthesis of momilactone A-B''', '''phytocassanes A-E''' and have '''little or no''' involvement in '''accumulation of oryzalexin A-F''' and '''oryzalexin S'''<ref name="ref3"/>.
 +
 
 +
*''OsMPK3'' and ''OsMPK6'' each '''co-immunoprecipitated''' ''OsMKK6'', and both were '''directly phosphorylated''' by OsMKK6 in vitro. ''OsMKK6'' and ''OsMPK3'' constitute a '''moderately low-temperature signalling pathway''' and '''regulate cold stress tolerance''' in rice<ref name="ref4"/>.
 +
 
 +
*Regulated genes were identified in overexpressed constitutively activated OsMKK6 and they were further subdivided on the basis of functional categories, viz. transcription, metabolism, signaling, defense and unknown function. These findings suggest the '''possible physiological role''' of ''OsMKK6'' in '''modulating gene expression''' and '''signaling pathways''' during different stresses<ref name="ref6"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524]
 +
 
 +
===Mutation===
 +
*independent transgenic lines<ref name="ref2"/>:
 +
**E1, E2, E7, E8, E9, E10, E13, E16, E17 and E18
 +
**All transgenic lines except E8, showed higher steady state level of ''OsMKK6'' in overexpressed transgenic line compared to wild type (WT) and E10, E13, E18 transgenic lines showing '''higher transcript level''' were used for stress tolerance studies.
 +
**The effective quantum yield of transgenic lines were also similar with that of WT indicating non significant change of photosynthesis in overexpressed transgenic lines as compared to WT.
 +
*Two homozygous OsMKK6EE-overexpression lines<ref name="ref3"/>:
 +
**OsMKK6EE-10
 +
**OsMKK6EE-18
 +
*'''Enhanced chilling tolerance''' was observed in the transgenic plants overexpressing OsMKK6DD<ref name="ref4"/>.
 +
*OsMKK6DD showed a substantially '''higher kinase activity''' against MPK3m than did the wild-type OsMKK6. By contrast, OsMKK6D showed weaker kinase activity in vitro<ref name="ref4"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*Fast and transient transcript accumulation was also observed in case of ''OsMKK6'' '''by salt stress''' while ''OsMKK10-2'' showed significant increase in transcript accumulation only after. The transcript of only ''OsMKK4'' and ''OsMKK6'' showed '''upregulation''' more than threefolds due to '''cold stress'''<ref name="ref1"/>.
 +
 
 +
*''OsMKK6'' transcript '''increased''' around fivefold of the control after 1 and 3 h of cold stress before getting '''down regulated''' after 6 and 12 h. '''Heat stress''' resulted in twofold '''increase''' in the transcript of ''OsMKK1'', ''OsMKK3'', ''OsMKK4'', ''OsMKK6'' and ''OsMKK10-2'' after 1 and 3 h of exposure in elevated temperature<ref name="ref1"/>.
 +
 +
*Overexpression of '''constitutively active''' form of ''OsMKK6'' '''enhance tolerance to salt stress''' in rice. ''OsMKK6'' showed more transcript accumulation in both '''roots''' and '''leaves''' in '''salt stress''' whereas in '''cold stress''' transcript accumulation was '''higher in roots''' but showed '''less accumulation''' of transcript in '''drought stressed leaves'''<ref name="ref2"/>.
 +
 
 +
*Transcript of OsMKK6 was noticed in almost all the tissue and its accumulation was '''highest in mature roots'''<ref name="ref2"/>.
 +
 
 +
*Overexpressing constitutive active ''OsMKK6EE'' exhibited '''higher expression''' of genes of '''PA biosynthesis pathway''' upon '''UV stress''' and also upon '''infection with M. oryzae'''<ref name="ref3"/>.
 +
 
 +
*''OsMKK6'' showed '''UV induced expression pattern'''. '''Increased phosphorylation''' of GST-OsMKK6 upon UV elicitation indicates its involvement in UV stress<ref name="ref3"/>.  
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* ''OsMKK1'' and ''OsMKK6'' belong to '''group A''', ''OsMKK3'' to group B, ''OsMKK4'' to group C and ''OsMKK10-2'' to group D (Fig. 1)<ref name="ref1"/>.
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
*''OsMKK4'', ''OsMKK6'' and ''OsMKK10-2'' are involved in the '''regulation of cold signal''', ''OsMKK4'' and ''OsMKK6'' also have their role in salinity stress, ''OsMKK1'' might be involved in drought while none of the OsMKKs studied, seems to be involved in transducing heat stress <ref name="ref1"/>.
  
==Labs working on this gene==
+
==Structured Information==
Please input related labs here.
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Kumar K, Rao K P, Sharma P, et al. Differential regulation of rice mitogen activated protein kinase kinase (MKK) by abiotic stress[J]. Plant Physiology and Biochemistry, 2008, 46(10): 891-897.
 +
</ref>
 +
* <ref name="ref2">
 +
Kumar K, Sinha A K. Overexpression of constitutively active mitogen activated protein kinase kinase 6 enhances tolerance to salt stress in rice[J]. Rice, 2013, 6(1): 25.
 +
</ref>
 +
* <ref name="ref3">
 +
Wankhede D P, Kumar K, Singh P, et al. Involvement of mitogen activated protein kinase kinase 6 in UV induced transcripts accumulation of genes in phytoalexin biosynthesis in rice[J]. Rice, 2013, 6(1): 35.
 +
</ref>
 +
* <ref name="ref4">
 +
Guosheng X, Hideki K, Ryozo I. Biochemical identification of the OsMKK6-OsMPK3 signalling pathway for chilling stress tolerance in rice1[J]. Biochemical Journal, 2012, 443(1): 95-102.
 +
</ref>
 +
* <ref name="ref5">
 +
Hamel L P, Nicole M C, Sritubtim S, et al. Ancient signals: comparative genomics of plant MAPK and MAPKK gene families[J]. Trends in plant science, 2006, 11(4): 192-198.
 +
</ref>
 +
* <ref name="ref6">
 +
Kumar K, Sinha A K. Genome-wide transcriptome modulation in rice transgenic lines expressing engineered mitogen activated protein kinase kinase 6[J]. Plant signaling & behavior, 2014, 9(5).
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Latest revision as of 14:43, 14 February 2017

The rice gene Os01g0510100 was reported as OsMKK6 in 2008[1], 2013[2][3], 2012[4], OsMEK1 in 2006[5], respectively.

Annotated Information

Function

Figure 1. Phylogenetic relationship between MKKs from indica rice cultivar with the other known MKKs from different plants(from reference [1]).
  • Under UV stress OsMKK6 may have role in regulation of biosynthesis of momilactone A-B, phytocassanes A-E and have little or no involvement in accumulation of oryzalexin A-F and oryzalexin S[3].
  • OsMPK3 and OsMPK6 each co-immunoprecipitated OsMKK6, and both were directly phosphorylated by OsMKK6 in vitro. OsMKK6 and OsMPK3 constitute a moderately low-temperature signalling pathway and regulate cold stress tolerance in rice[4].
  • Regulated genes were identified in overexpressed constitutively activated OsMKK6 and they were further subdivided on the basis of functional categories, viz. transcription, metabolism, signaling, defense and unknown function. These findings suggest the possible physiological role of OsMKK6 in modulating gene expression and signaling pathways during different stresses[6].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524

Mutation

  • independent transgenic lines[2]:
    • E1, E2, E7, E8, E9, E10, E13, E16, E17 and E18
    • All transgenic lines except E8, showed higher steady state level of OsMKK6 in overexpressed transgenic line compared to wild type (WT) and E10, E13, E18 transgenic lines showing higher transcript level were used for stress tolerance studies.
    • The effective quantum yield of transgenic lines were also similar with that of WT indicating non significant change of photosynthesis in overexpressed transgenic lines as compared to WT.
  • Two homozygous OsMKK6EE-overexpression lines[3]:
    • OsMKK6EE-10
    • OsMKK6EE-18
  • Enhanced chilling tolerance was observed in the transgenic plants overexpressing OsMKK6DD[4].
  • OsMKK6DD showed a substantially higher kinase activity against MPK3m than did the wild-type OsMKK6. By contrast, OsMKK6D showed weaker kinase activity in vitro[4].

Expression

  • Fast and transient transcript accumulation was also observed in case of OsMKK6 by salt stress while OsMKK10-2 showed significant increase in transcript accumulation only after. The transcript of only OsMKK4 and OsMKK6 showed upregulation more than threefolds due to cold stress[1].
  • OsMKK6 transcript increased around fivefold of the control after 1 and 3 h of cold stress before getting down regulated after 6 and 12 h. Heat stress resulted in twofold increase in the transcript of OsMKK1, OsMKK3, OsMKK4, OsMKK6 and OsMKK10-2 after 1 and 3 h of exposure in elevated temperature[1].
  • Overexpression of constitutively active form of OsMKK6 enhance tolerance to salt stress in rice. OsMKK6 showed more transcript accumulation in both roots and leaves in salt stress whereas in cold stress transcript accumulation was higher in roots but showed less accumulation of transcript in drought stressed leaves[2].
  • Transcript of OsMKK6 was noticed in almost all the tissue and its accumulation was highest in mature roots[2].
  • Overexpressing constitutive active OsMKK6EE exhibited higher expression of genes of PA biosynthesis pathway upon UV stress and also upon infection with M. oryzae[3].
  • OsMKK6 showed UV induced expression pattern. Increased phosphorylation of GST-OsMKK6 upon UV elicitation indicates its involvement in UV stress[3].

Evolution

  • OsMKK1 and OsMKK6 belong to group A, OsMKK3 to group B, OsMKK4 to group C and OsMKK10-2 to group D (Fig. 1)[1].

Knowledge Extension

  • OsMKK4, OsMKK6 and OsMKK10-2 are involved in the regulation of cold signal, OsMKK4 and OsMKK6 also have their role in salinity stress, OsMKK1 might be involved in drought while none of the OsMKKs studied, seems to be involved in transducing heat stress [1].

Structured Information

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Kumar K, Rao K P, Sharma P, et al. Differential regulation of rice mitogen activated protein kinase kinase (MKK) by abiotic stress[J]. Plant Physiology and Biochemistry, 2008, 46(10): 891-897.
  2. 2.0 2.1 2.2 2.3 Kumar K, Sinha A K. Overexpression of constitutively active mitogen activated protein kinase kinase 6 enhances tolerance to salt stress in rice[J]. Rice, 2013, 6(1): 25.
  3. 3.0 3.1 3.2 3.3 3.4 Wankhede D P, Kumar K, Singh P, et al. Involvement of mitogen activated protein kinase kinase 6 in UV induced transcripts accumulation of genes in phytoalexin biosynthesis in rice[J]. Rice, 2013, 6(1): 35.
  4. 4.0 4.1 4.2 4.3 Guosheng X, Hideki K, Ryozo I. Biochemical identification of the OsMKK6-OsMPK3 signalling pathway for chilling stress tolerance in rice1[J]. Biochemical Journal, 2012, 443(1): 95-102.
  5. Hamel L P, Nicole M C, Sritubtim S, et al. Ancient signals: comparative genomics of plant MAPK and MAPKK gene families[J]. Trends in plant science, 2006, 11(4): 192-198.
  6. Kumar K, Sinha A K. Genome-wide transcriptome modulation in rice transgenic lines expressing engineered mitogen activated protein kinase kinase 6[J]. Plant signaling & behavior, 2014, 9(5).

Structured Information

Gene Name

Os01g0510100

Description

MAP kinase kinase 1

Version

NM_001049699.1 GI:115436903 GeneID:4324023

Length

5204 bp

Definition

Oryza sativa Japonica Group Os01g0510100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:19561678..19566881

Sequence Coding Region

19561920..19561993,19562493..19562580,19562930..19563067,19563555..19563779,19563911..19564093
,19564212..19564432,19566375..19566420,19566519..19566611

Expression

GEO Profiles:Os01g0510100

Genome Context

<gbrowseImage1> name=NC_008394:19561678..19566881 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:19561678..19566881 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagggggaagaagccgcacaaggagctcaagctctccgtgcctgcgcaggagacgcccgtcgacaagttcctgaccgcgagtggtacattcaaggatggtgaactgcggcttaatcaaagaggtttgcagcttatatccgaggaaactgcagatgaacctcagtcaacaaacctgaaggtggaagatgttcagttgtcaatggatgaccttgagatgattcaagtcattggtaaggggagtggtggtatcgtccaactagttcggcacaagtgggtggggacattatatgccttgaagggcatacaaatgaacattcaagaggcagttcgcaaacaaatagtacaagagctcaaaataaatcaagcaacacagaacgcacatatagtcctttgccaccaatctttctaccataatggtgtaatatatcttgttctagaatacatggaccgtggatctcttgcagatatcattaaacaagtcaaaacaattctggagccatacctggcagtactttgcaaacaggttttggagggtctactgtatcttcatcatgaaaggcatgtgattcacagggatataaagccatctaacttgttagttaaccgtaaaggtgaagtaaagattaccgattttggggtaagtgcggtgctagcaagttcaatgggtcagcgggatacgtttgttggaacctacaactatatggcgcctgagcgtattagtggaagctcctatgactacaagagtgacatatggagtttgggcttagtaatactcgagtgtgccattggtcggttcccctatataccttcagaaggggaaggttggttaagcttctacgaattattagaagcaattgttgaccagccaccaccctctgcaccagcggaccagttctctccagaattttgtgcatttatctcctcctgcatacaaaaggatcctgcggagcggatgtctgcttcagaactcttgaatcatcctttcatcaagaagtttgaggataaggatttagacctgcgcattcttgtcgagagccttgaacctccaatgaatatatccgagtaa</cdnaseq>

Protein Sequence

<aaseq>MRGKKPHKELKLSVPAQETPVDKFLTASGTFKDGELRLNQRGLQ LISEETADEPQSTNLKVEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGI QMNIQEAVRKQIVQELKINQATQNAHIVLCHQSFYHNGVIYLVLEYMDRGSLADIIKQ VKTILEPYLAVLCKQVLEGLLYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVSAVL ASSMGQRDTFVGTYNYMAPERISGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGW LSFYELLEAIVDQPPPSAPADQFSPEFCAFISSCIQKDPAERMSASELLNHPFIKKFE DKDLDLRILVESLEPPMNISE</aaseq>

Gene Sequence

<dnaseqindica>243..316#816..903#1253..1390#1878..2102#2234..2416#2535..2755#4698..4743#4842..4934#acgctctccttccttccttccttcttcgcttcttccgacgccacttcacctctccttcctccctccctcgccgccgcgggctgcttcctccctccctcccgccgcgtcccgccactcccggctgattactcgagccgccgcggggcagatccgtgccgggataggcctctcgctcgcgcttcggtcccccgtctcttaccggcggataaaccctaaccggagaggaggaggagggggaggccatgagggggaagaagccgcacaaggagctcaagctctccgtgcctgcgcaggagacgcccgtcgacaagttcctgtagggtccccctccctcggttccctgggcctgaaacgtgctcttttttttctttttttttttactgtcacttgatttcgttttcctttgtgtgttctcctttggagcgatcgggtgtcatgaactttcgaggttttgcctctggtatagaagggcttctgtgtttttttttagttatttgttgacgattttggagttcagatcgaattgtcttgcatagtgtcttactgtgattttggggttagttatgaactgagatggagataagatttacagaagcgtaggtctacttatactgtctaactgatcttttgcttgaaatatctatgatctgagttgctgaactgactcttcaatcctcacttagagtggctgaaatgctattcgtggttccagatcgtttgttattttgtttatccatcagcctaatcgttgatttatgtttcgggagttcgtggtaaaatttaatagctgtcactgatcgctggtgctcctttaggaccgcgagtggtacattcaaggatggtgaactgcggcttaatcaaagaggtttgcagcttatatccgaggaaactgcagatgaacctgtgagttcctggtgccatggctactttttttgtttgttcatatctccctactgggttcatgtaaactgctttatcgtactccttatggtgacatgtaggttagtgtagaagcacatgtacaggttgactagttcagtcaaaccttatcatgcttctgttgattttcatttggctgattgaatgcaatactcacttgcaatgcatgggatccatgccactcatgcattctcgcaatgtattatgtgctgcaatagtgctaaggaatcattgtgtaaacatttcagagtttatccatggatataacattgttcacatttctcaatttctgtttcatctttatgtcttccagcagtcaacaaacctgaaggtggaagatgttcagttgtcaatggatgaccttgagatgattcaagtcattggtaaggggagtggtggtatcgtccaactagttcggcacaagtgggtggggacattatatgccttgaaggtaatttccattacacaaaatccatctagtgttccacactaattcttaaatggaaaatgtatatcttgtggctgcatcaggctgcgagtccttcagttgaactgtttctctatctttatgtttgtaatcatggaaagctggaagtcaatctctcagttccattttgaacatgtttatcataatcagattattctgcatcatagcatttgattgattttttaatcaatttggtagtgttggcacctattagtatgttccctgttgaaattaggtggggcattctacataaatggtgtagcagaagcatctgtcgtcagcttacgtgttgcatgcaatatctacattgaactctgattttcaattaatattgatgctaatgaagaacatcatgttatgatgttcagatcaatcaagaattctgtgcattgtccctggtattcatactgctgtggcatttaattaactagcattgcaattctgtccacagggcatacaaatgaacattcaagaggcagttcgcaaacaaatagtacaagagctcaaaataaatcaagcaacacagaacgcacatatagtcctttgccaccaatctttctaccataatggtgtaatatatcttgttctagaatacatggaccgtggatctcttgcagatatcattaaacaagtcaaaacaattctggagccatacctggcagtactttgcaaacaggttagcataaacttagccttttatttctaactttccctgttttcggaataagcttggaattttgtcgcatctatccagttgaaaaagtattctaacgtaaaaaaacattgcatgatattttgacaactcaggttttggagggtctactgtatcttcatcatgaaaggcatgtgattcacagggatataaagccatctaacttgttagttaaccgtaaaggtgaagtaaagattaccgattttggggtaagtgcggtgctagcaagttcaatgggtcagcgggatacgtttgttggaacctacaactatatggcggtatgttgaaataatgacctgctttatttatgtaccccttagtctatgttcaagacagtgatctgatctggaattcataaatttgttctcatagtttctacctttcttcctagttcagcctgagcgtattagtggaagctcctatgactacaagagtgacatatggagtttgggcttagtaatactcgagtgtgccattggtcggttcccctatataccttcagaaggggaaggttggttaagcttctacgaattattagaagcaattgttgaccagccaccaccctctgcaccagcggaccagttctctccagaattttgtgcatttatctcctcctggtatgataatcatctctctgaaattacacatgaaattagcttttattactgctttcctgagtattcccctgcatactactttggctgttttgctctatatttcaaagtcttgttagtcttttgtgtgtgagtccaaaaaaaaaaaaaactggaactgcaaaagaaatgtttggaattattgagaacgctatttgtaacttgtatatatgtgtagcaattccctcttccaggaagttgatgtattttctgtaccaaagtgttccttttgttaacctttgaatatgcttagctttattgttagcatttgtgatcatgaagaagttgatggacacaattagtgaaatccacaatccttttttttaaaaattttctacaaccttttatattgcagtcgatcctgcaatgttatccactggaaagttgtaacttcctgcaattttgtcagatcactttgcataccaagaggcttaaagtgtaactttgcagccaatggctcagtgggcaaaacatgtagcagtgggtttgagcaagcaacctttggtttacttttgtagaccatagttcttagcattttaacgtgatacctacatggccatattaaaaattgtattagtcctaaacgagatgcatgtagtctattaaggtcttaacttcatcattgcttgagcactgaggtgtccaggggctactgtcacagctgctgcctcacctaattgatcatgtaccactctttagatggtgagtctagtatttgccacactctggaacctaattgatttcttgccaccctttagatggtgttggtttaccaattgcctctttgaacttaattgcatctcctttcctattttgctcttgttcaatgctatgcttcaaaagaacaagtggaataactgatttgatgaagataagggagaaagctggaggtcagaagtcagcaaatctttcagtgtccatggtcaccctcaaacgttagtggtacttattgacaaaaagctgatctggagctccaacttgtagaacttggcaagctttctgtatctagaacagaagcatgagcaagaattttgcaccaagcaattaaaggttataatggatctgaatgactaaaacccaagaaagaatcttgcaccaagtaatattgctcgttcttaccacaaaggaatcaaatccagacaaaagtagtcatcaatgtgatgaaatcacaggagataagccaggtgagcttgatgcacttggttaggtcagaggagctctccaatgagtcgatggaagaggccatggtgctggggagctggagccctagctgcagcaaatccagacaaaagtagatggtgggggtatgcggcgctatgggtgtggaaggcagtttaggctattgctggcatctctgaattgaagaggggtggaaacttgaggtcagatgatggagtaagaagggcaaaatgagaacttgtggtggggattgtgtaaaaaaaaaaggtagatgcaattaggtacaaaatagcaatattctagatcaagcacatctaattggtggcattttatcaattagtttctagggtgattgcaaatcaagttatttaaagggcagcaaaatatctaggtgttttccagattaataaaacctttgctgtgagatagttacggactaaacagtagtatacccaccctggcccagtgtcccacatcatgactagtatcaatttgcgttgctgtcagattgttgtttacagaagtacttttgaacttctttgcttaagtcaaattatgcatgcaaataacagtgtcttgtgtgctcctatatctgatttcatgactaatctataaggatacaagcatggcttgagggtaaataacagtttcttccaacttatcattaaagattcatttcatcagcttatcatagtctaatcttatttattgttacattgctttgcagcatacaaaaggatcctgcggagcggatgtctgcttcagaactcttggtcagcattgccttctatttaataatttttgtagcgaacttaactgtaataacatctttcgaccatcttgttctgaactgtcatatatattcttgcagaatcatcctttcatcaagaagtttgaggataaggatttagacctgcgcattcttgtcgagagccttgaacctccaatgaatatatccgagtaacttgtcattgggaggaatgaggttttgtcggtctcttggtagcggcacatgttccctgcatgcgatgtagtgtgtatgatgttgaaaattcgggaggagttgcagtaatgtatcggtataatttttctttacctaaggcccttttgttgcctctttttatggtcctgtgacttgcgagcatgacaatagagggaatcatgatttcaccttcgtattgcatggtgtcttatcgtagttcttgctgcgagtaattggtccccaatgtccttt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0510100, RefSeq:Os01g0510100