Difference between revisions of "Os01g0102300"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
 
(6 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0102300''''' was reported as '''''OsTLP27''''' in 2012 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:227-Os01g0102300.png|right|thumb|527px|'''Figure 4.''' ''Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os01g0102300''''' '''<=>''' '''''OsTLP27,TLP27'''''
 +
 
===Function===
 
===Function===
The thylakoid lumen proteins are highly associated with photosynthesis functionally.
+
 
 +
* The rice gene '''''OsTLP27'''''  encodes a 27-kDa of 257-amino acid with 53% homology to the AtTLP gene from Arabidopsis thaliana.
 +
* '''''OsTLP27''''' is novel function gene for photosynthesis and chloroplast development in rice.
 +
* '''''OsTLP27''''' enhanced photochemical efficiency of PSII of rice.
 +
* '''''OsTLP27''''' positively regulates chloroplast development and functions in rice
 +
 
 +
===Phenotypic analysis===
 +
* Constitutive expression of '''''OsTLP27''''' under the control of CaMV 35S promoter resulted in increased pigment content and enhanced photochemical efficiency in terms of the values of maximal photochemical efficiency of photosystem II (PSII) (Fv/Fm ), effective quantum yield of PSII (�PSII), electron transport rate (ETR) and photochemical quenching (qP).
 +
* Overexpression of '''''OsTLP27''''' also enhanced transcript levels of genes related to chloroplast function and caused changes in the grana size and number.
 +
* Further study showed that the structure and polypeptide composition of the photosynthetic apparatus were altered in transgenic lines overexpressing '''''OsTLP27'''''.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* '''''OsTLP27''''' transcripts accumulated specifically in green tissues such as the leaf blade and leaf sheath, and the levels of its transcripts followed a circadian rhythm.
  
===Evolution===
+
===Subcellular localization===
Please input evolution information here.
+
* '''''OsTLP27''''' was localized in chloroplasts of rice leaf
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* College of Biological Engineering, Chongqing University, Chongqing 400030, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Hu F, Kang Z, Qiu S, Wang Y, Qin F, Yue C, Huang J, Wang G. Overexpression of
 +
OsTLP27 in rice improves chloroplast function and photochemical efficiency. Plant
 +
Sci. 2012 Oct;195:125-34. doi: 10.1016/j.plantsci.2012.06.006. PubMed PMID:
 +
22921006.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0102300|
 
Description = Conserved hypothetical protein|
 
Version = NM_001048282.1 GI:115433977 GeneID:4326466|
 
Length = 1140 bp|
 
Definition = Oryza sativa Japonica Group Os01g0102300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:133300..134439|
 
CDS = 133311..133615,133698..133824,133912..134253|
 
GCID = <gbrowseImage1>
 
name=NC_008394:133300..134439
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:133300..134439
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgacgtcatcattatcatcatccacagcctctgctgctgcttgttgcaagagtagaagtcgtaatcctcctccggcgccggcgccacacactagtactgcacgagtagttcgcagcagcaggcggaggcttctcttagtattcttctccgcagaggcggcggcggctgcgacgagcggtctcatccagaccccgtgtgggcaagcctaccctttcgctggcaccaacgtgaagaagccgcagccgccgtccaccccttactcccaatcccaatcgcagcagcagtttggcctcgacgccaaagggaggattagggcgtgcccgtcgacgaaccccggatgcgtgtccacaaaccccacggtgggcgcatcttgctccttggcctccccgctcatcgtccccgctaatacaccaacggacaaggccgccgcttcgctgcgcgaggctatcctcaagacgcagaggaatgcggtgatcaaagccgacgaggagacggcgtacgggcactacatccaggcggaggtcgacggcggcgcaggccgcgacgtgatggagttcctcctcaaggaatcccagtcccagtcccaggaggtggtggccgcgtaccgatgcgtcgccaccaaggtcatcttcgtctaccccttcaccactgccgtcggcgattcaagagggcagagccagaggatcgccgccgtcgcccaggagctcggatggtacgccccggacctactcaacgccgccaccgccgacgaccactctatcctcgactattaa</cdnaseq>|
 
AA = <aaseq>MTSSLSSSTASAAACCKSRSRNPPPAPAPHTSTARVVRSSRRRL                    LLVFFSAEAAAAATSGLIQTPCGQAYPFAGTNVKKPQPPSTPYSQSQSQQQFGLDAKG                    RIRACPSTNPGCVSTNPTVGASCSLASPLIVPANTPTDKAAASLREAILKTQRNAVIK                    ADEETAYGHYIQAEVDGGAGRDVMEFLLKESQSQSQEVVAAYRCVATKVIFVYPFTTA                    VGDSRGQSQRIAAVAQELGWYAPDLLNAATADDHSILDY</aaseq>|
 
DNA = <dnaseqindica>12..316#399..525#613..954#gtacgtttgtaatgacgtcatcattatcatcatccacagcctctgctgctgcttgttgcaagagtagaagtcgtaatcctcctccggcgccggcgccacacactagtactgcacgagtagttcgcagcagcaggcggaggcttctcttagtattcttctccgcagaggcggcggcggctgcgacgagcggtctcatccagaccccgtgtgggcaagcctaccctttcgctggcaccaacgtgaagaagccgcagccgccgtccaccccttactcccaatcccaatcgcagcagcagtttggcctcgacgccaaagggtaattaactaaaccggccgccacagatctggatggatcgatcttaaaattaagaaagagattatatatattatggatgcaggaggattagggcgtgcccgtcgacgaaccccggatgcgtgtccacaaaccccacggtgggcgcatcttgctccttggcctccccgctcatcgtccccgctaatacaccaacggacaaggccgccgctgtaagtgtacgcacgcacgcatttgttattcatttaatatagcagtatttgtttctgaattagtaattcgatgtgaatgaatgacagtcgctgcgcgaggctatcctcaagacgcagaggaatgcggtgatcaaagccgacgaggagacggcgtacgggcactacatccaggcggaggtcgacggcggcgcaggccgcgacgtgatggagttcctcctcaaggaatcccagtcccagtcccaggaggtggtggccgcgtaccgatgcgtcgccaccaaggtcatcttcgtctaccccttcaccactgccgtcggcgattcaagagggcagagccagaggatcgccgccgtcgcccaggagctcggatggtacgccccggacctactcaacgccgccaccgccgacgaccactctatcctcgactattaaccaaggccatacatatgcttgcttcattatctctagtctgtacaagtacaactcgtccaaattcattcatccatccatccatccacgacacatatacaaatactaatctattattactactaagtagtactagtagccaccgatatatatacacaacaaatgtattaatcaaaatgctaatttatt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048282.1 RefSeq:Os01g0102300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 15:32, 14 February 2017

The rice Os01g0102300 was reported as OsTLP27 in 2012 [1] by researchers from China.

Annotated Information

Figure 4. Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.[1].

Gene Symbol

  • Os01g0102300 <=> OsTLP27,TLP27

Function

  • The rice gene OsTLP27 encodes a 27-kDa of 257-amino acid with 53% homology to the AtTLP gene from Arabidopsis thaliana.
  • OsTLP27 is novel function gene for photosynthesis and chloroplast development in rice.
  • OsTLP27 enhanced photochemical efficiency of PSII of rice.
  • OsTLP27 positively regulates chloroplast development and functions in rice

Phenotypic analysis

  • Constitutive expression of OsTLP27 under the control of CaMV 35S promoter resulted in increased pigment content and enhanced photochemical efficiency in terms of the values of maximal photochemical efficiency of photosystem II (PSII) (Fv/Fm ), effective quantum yield of PSII (�PSII), electron transport rate (ETR) and photochemical quenching (qP).
  • Overexpression of OsTLP27 also enhanced transcript levels of genes related to chloroplast function and caused changes in the grana size and number.
  • Further study showed that the structure and polypeptide composition of the photosynthetic apparatus were altered in transgenic lines overexpressing OsTLP27.

Expression

  • OsTLP27 transcripts accumulated specifically in green tissues such as the leaf blade and leaf sheath, and the levels of its transcripts followed a circadian rhythm.

Subcellular localization

  • OsTLP27 was localized in chloroplasts of rice leaf

You can also add sub-section(s) at will.

Labs working on this gene

  • College of Biological Engineering, Chongqing University, Chongqing 400030, China

References

  1. 1.0 1.1 Hu F, Kang Z, Qiu S, Wang Y, Qin F, Yue C, Huang J, Wang G. Overexpression of OsTLP27 in rice improves chloroplast function and photochemical efficiency. Plant Sci. 2012 Oct;195:125-34. doi: 10.1016/j.plantsci.2012.06.006. PubMed PMID: 22921006.


Structured Information