Difference between revisions of "Os09g0470500"

From RiceWiki
Jump to: navigation, search
(Mutant)
 
(5 intermediate revisions by 3 users not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Oshox-1.jpg|right|thumb|327x|'''Figure 2B.''' Nuclear localization of Oshox4 protein. GFP alone was localized in cytosol of onion skin cells. (a)Oshox4-GFP; Nuclear localised; (c) DAPI staining; (d) a bright light image. Bar=50lm.(from reference) <ref name="ref4" />.]]
 
===Function===
 
===Function===
 
''Oshox4'' belongs to the homeodomain leucine zipper (HD-Zip) genes that encode transcription factors that contain conserved DNA motif called the homeobox<ref name="ref1" />. There are four family members in HD-Zip including I, I, II, III and IV <ref name="ref2" />, and Oshox4 which locates in chromosome 9 belongs to HD-Zip I. In addition, it is suggested that all HD-Zip I and II proteins family members can form homodimers and also heterodimers<ref name="ref3" />.
 
''Oshox4'' belongs to the homeodomain leucine zipper (HD-Zip) genes that encode transcription factors that contain conserved DNA motif called the homeobox<ref name="ref1" />. There are four family members in HD-Zip including I, I, II, III and IV <ref name="ref2" />, and Oshox4 which locates in chromosome 9 belongs to HD-Zip I. In addition, it is suggested that all HD-Zip I and II proteins family members can form homodimers and also heterodimers<ref name="ref3" />.
Line 8: Line 9:
 
''Oshox4'' expresses in leaf primordial of shoot apex, and in young leaves without polar distribution, even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA. ''Oshox4'' expresses more in drought resistant than in drought-sensitive rice cultivars <ref name="ref1" />.
 
''Oshox4'' expresses in leaf primordial of shoot apex, and in young leaves without polar distribution, even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA. ''Oshox4'' expresses more in drought resistant than in drought-sensitive rice cultivars <ref name="ref1" />.
  
 +
[[File:Oshox-2.jpg|right|thumb|327px|'''Figure 3A.'''Over-expression of ''Oshox4'' induced a semi-dwarf phenotype in transgenic rice. (A) Comparison between wild type and an ''Oshox4'' over-expressing line (H4) at vegetative and reproductive stages. Bars=15 cm.(from reference) <ref name="ref4" />.'']]
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.
 
===Subcellular localization===
 
===Subcellular localization===
To understand the subcellular localization of ''Oshox4'', researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells <ref name="ref4" />(Fig. 2B).[[File:Oshox-1.jpg|right|thumb|430px|'''Figure 2B.''' Nuclear localization of Oshox4 protein. GFP alone was localized in cytosol of onion skin cells. (a)Oshox4-GFP; Nuclear localised; (c) DAPI staining; (d) a bright light image. Bar=50lm.(from reference) <ref name="ref4" />.]]
+
To understand the subcellular localization of ''Oshox4'', researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells <ref name="ref4" />(Fig. 2B).
 +
[[File:Oshox-3.jpg|right|thumb|327px|'''Figure 5.''' Growth of ''Oshox4''-over expressing and wild type plants treated with GA3 at different concentrations. Wild type (a) and ''Oshox4''-overexpressing plants (b) at four-leaf stage were transferred to hydroponic culture media containing GA3 at the concentration of 0 (1), 0.01 (2), 0.05 (3), 0.1 (4), 0.5 (5), 1 (6), 10 (7), or 20lM (8). The lengths of the second leaf sheaths were measured 12 days after the treatment. (from reference) <ref name="ref4" />.'']]
  
 
===Mutant===
 
===Mutant===
When Oshox4 is over expressed in more than 40 independent transgenic T0 plants, there are 27 semi-dwarf phenotype plants that possess only a half of the wild ones as well as two times tillers than the normal wild plants (Fig. 3A).
+
* When Oshox4 is over expressed in more than 40 independent transgenic T0 plants, there are 27 semi-dwarf phenotype plants that possess only a half of the wild ones as well as two times tillers than the normal wild plants (Fig. 3A).
[[File:Oshox-2.jpg|right|thumb|300px|'''Figure 3A.'''Over-expression of ''Oshox4'' induced a semi-dwarf phenotype in transgenic rice. (A) Comparison between wild type and an ''Oshox4'' over-expressing line (H4) at vegetative and reproductive stages. Bars=15 cm.(from reference) <ref name="ref4" />.'']]
 
  
 +
* This may due to the reduced transgenic plants cell elongation that occurs in epidermal, elongating and intercalary meristem cells compared to wild type. And Oshox4 may interact with the fragment corresponding to -1080 to-1662 from the initiation ATG codon of the ''YAB1''. Further experiments show that these Oshox4-over-expression plants with semi-dwarf cannot be rescued by adding GA3 (Fig 5), but the mutant plants with semi-dwarf caused by YAB1-over-expression can rehabilitate to the same height of the wild type <ref name="ref5" />.
  
This may due to the reduced transgenic plants cell elongation that occurs in epidermal, elongating and intercalary meristem cells compared to wild type. And Oshox4 may interact with the fragment corresponding to -1080 to-1662 from the initiation ATG codon of the ''YAB1''. Further experiments show that these Oshox4-over-expression plants with semi-dwarf cannot be rescued by adding GA3 (Fig 5), but the mutant plants with semi-dwarf caused by YAB1-over-expression can rehabilitate to the same height of the wild type <ref name="ref5" />.  
+
* In Oshox4 over expressed mutants, both the GA metabolic gene expression and the amylase production change. At the same time, the GA upregulate the expression level of ''Oshox4''<ref name="ref4" />. Oshox4 knock-down plants by the expression of RNAi vector with a gene-specific segmet of  ''Oshox4'' show no significant changes, which may due to the function of other HD-Zip I in rice <ref name="ref4" />.
[[File:Oshox-3.jpg|right|thumb|430px|'''Figure 5.''' Growth of ''Oshox4''-over expressing and wild type plants treated with GA3 at different concentrations. Wild type (a) and ''Oshox4''-overexpressing plants (b) at four-leaf stage were transferred to hydroponic culture media containing GA3 at the concentration of 0 (1), 0.01 (2), 0.05 (3), 0.1 (4), 0.5 (5), 1 (6), 10 (7), or 20lM (8). The lengths of the second leaf sheaths were measured 12 days after the treatment. (from reference) <ref name="ref4" />.'']]
 
  
In Oshox4 over expressed mutants, both the GA metabolic gene expression and the amylase production change. At the same time, the GA upregulate the expression level of ''Oshox4''<ref name="ref4" />. Oshox4 knock-down plants by the expression of RNAi vector with a gene-specific segmet of  ''Oshox4'' show no significant changes, which may due to the function of other HD-Zip I in rice <ref name="ref4" />. 
+
* Considering the previous reports about Arabidopsis<ref name="ref6" /> and gibberellin biosynthesis <ref name="ref7" /> and other evidences, it is predicted that Oshox4 function in GA signaling.
 
 
Considering the previous reports about Arabidopsis<ref name="ref6" /> and gibberellin biosynthesis <ref name="ref7" /> and other evidences, it is predicted that Oshox4 function in GA signaling.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, China
 +
*Institut de Biotechnologie des Plantes, Universite ´ de Paris-sud 11, France
 +
*Laboratory of Cellular Signaling and Molecular Pharmacology,
 +
*Institute of Biology, National Center for Scientific Research, Greece
 +
*Research Center for Biotechnology, Indonesian Institute of Sciences (LIPI), Indonesia
 +
*Department of Physiological Botany, EBC, Uppsala University, Sweden
  
 
==References==
 
==References==
Line 40: Line 45:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0470500|
 
Description = Homeodomain leucine zipper protein|
 
Version = NM_001069971.1 GI:115479684 GeneID:4347333|
 
Length = 1716 bp|
 
Definition = Oryza sativa Japonica Group Os09g0470500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:18556879..18558594|
 
CDS = 18557207..18557276,18557394..18557740,18557867..18558283|
 
GCID = <gbrowseImage1>
 
name=NC_008402:18556879..18558594
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:18556879..18558594
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtgatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactga</cdnaseq>|
 
AA = <aaseq>MKRPGGAGGGGGSPSLVTMANSSDDGYGGVGMEAEGDVEEEMMA                    CGGGGEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRAR                    WKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVK                    EEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAPAATDALAPEACTFLGAPPAAGAG                    AGAAAAASHEEVFFHGNFLKVEEDETGFLDDDEPCGGFFADDQPPPLSSWWAEPTEHW                    N</aaseq>|
 
DNA = <dnaseqindica>329..398#516..862#989..1405#gaaaacagaaaggaaaccgagaaagagagagagagagagagaggtagggagggaagaagagtcactccacactccacactctcatcccctggtccctttcttggatcatgagaaaccgcgcaacaaaattgcaattctaggcagcatttggaccggggacttggctacgtggtgtttggccatggatcgcagcgtggaattaagaccggcgaggactcagcgacggaggcacccgcgtcattcctacgcttctgtgcccgtcgtcttctcgcagtgagagagagagagagatcgaccaggcgttcactgaattttactagaactcggcatgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtggtaatctttgttctttggttttccttttgtggcaattcattctttggaggtgatggtgtagtgtgatatgtgcgggaaattgagtgttttgtaattgtacatgcgtgttttgattagatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgaggtacgtgccgactgagtcgctgccctgccgtgccgcctgagctgttgctctgcgtgactgcgtcgagcagtcgttcgtttgcgcgcataatgtctgatggcttcttggtcgcgcgaattgtggcagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactgaagcaaatccggcgtaaccgcagccgagagagagagttggaaaacactatgcctgggggaataaagaattctgcaggaaagcagggtcttatctgcaattttgtaaaaaaaatggacctctacgtacttctctagtctcttttgccaattctcgcgcacattagctgtagcactgcagtgtagtaaaatcctactactccattacctctccaatttctagctctcacttccctacttaaactcatctgagctctaatgtaagcatatgccatccaaaatggaccataaatatgtcactagcagtaggatggt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069971.1 RefSeq:Os09g0470500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 00:39, 15 February 2017

Please input one-sentence summary here.

Annotated Information

Figure 2B. Nuclear localization of Oshox4 protein. GFP alone was localized in cytosol of onion skin cells. (a)Oshox4-GFP; Nuclear localised; (c) DAPI staining; (d) a bright light image. Bar=50lm.(from reference) [1].

Function

Oshox4 belongs to the homeodomain leucine zipper (HD-Zip) genes that encode transcription factors that contain conserved DNA motif called the homeobox[2]. There are four family members in HD-Zip including I, I, II, III and IV [3], and Oshox4 which locates in chromosome 9 belongs to HD-Zip I. In addition, it is suggested that all HD-Zip I and II proteins family members can form homodimers and also heterodimers[4].

Expression

Oshox4 expresses in leaf primordial of shoot apex, and in young leaves without polar distribution, even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA. Oshox4 expresses more in drought resistant than in drought-sensitive rice cultivars [2].

Figure 3A.Over-expression of Oshox4 induced a semi-dwarf phenotype in transgenic rice. (A) Comparison between wild type and an Oshox4 over-expressing line (H4) at vegetative and reproductive stages. Bars=15 cm.(from reference) [1].

Evolution

Please input evolution information here.

Subcellular localization

To understand the subcellular localization of Oshox4, researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells [1](Fig. 2B).

Figure 5. Growth of Oshox4-over expressing and wild type plants treated with GA3 at different concentrations. Wild type (a) and Oshox4-overexpressing plants (b) at four-leaf stage were transferred to hydroponic culture media containing GA3 at the concentration of 0 (1), 0.01 (2), 0.05 (3), 0.1 (4), 0.5 (5), 1 (6), 10 (7), or 20lM (8). The lengths of the second leaf sheaths were measured 12 days after the treatment. (from reference) [1].

Mutant

  • When Oshox4 is over expressed in more than 40 independent transgenic T0 plants, there are 27 semi-dwarf phenotype plants that possess only a half of the wild ones as well as two times tillers than the normal wild plants (Fig. 3A).
  • This may due to the reduced transgenic plants cell elongation that occurs in epidermal, elongating and intercalary meristem cells compared to wild type. And Oshox4 may interact with the fragment corresponding to -1080 to-1662 from the initiation ATG codon of the YAB1. Further experiments show that these Oshox4-over-expression plants with semi-dwarf cannot be rescued by adding GA3 (Fig 5), but the mutant plants with semi-dwarf caused by YAB1-over-expression can rehabilitate to the same height of the wild type [5].
  • In Oshox4 over expressed mutants, both the GA metabolic gene expression and the amylase production change. At the same time, the GA upregulate the expression level of Oshox4[1]. Oshox4 knock-down plants by the expression of RNAi vector with a gene-specific segmet of Oshox4 show no significant changes, which may due to the function of other HD-Zip I in rice [1].
  • Considering the previous reports about Arabidopsis[6] and gibberellin biosynthesis [7] and other evidences, it is predicted that Oshox4 function in GA signaling.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, China
  • Institut de Biotechnologie des Plantes, Universite ´ de Paris-sud 11, France
  • Laboratory of Cellular Signaling and Molecular Pharmacology,
  • Institute of Biology, National Center for Scientific Research, Greece
  • Research Center for Biotechnology, Indonesian Institute of Sciences (LIPI), Indonesia
  • Department of Physiological Botany, EBC, Uppsala University, Sweden

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Mingqiu Dai, Yongfeng Hu, Qian Ma, Yu Zhao, Dao-Xiu Zhou. Functional analysis of rice HOMEOBOX4 (Oshox4) gene reveals a negative function in gibberellin responses. Plant Mol Biol (2008) 66:289–301.
  2. 2.0 2.1 Adamantia Agalou, Sigit Purwantomo, Elin O¨verna¨s et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members Plant Mol Biol (2008) 66:87–103.
  3. Sessa G, Carabelli M, Ruberti I (1994) Identification of distinct families of HD-Zip proteins inArabidopsis thaliana. In: Coruzzi GP (ed) Plant molecular biology. Springer-Verlag, Berlin, pp 412–426.
  4. A. H. Meijer, R. J. de Kam, I. d'Erfurth, W. Shen, J. H. C. Hoge. HD-Zip proteins of families I and II from rice: interactions and functional properties. Molecular and General Genetics MGG, February 2000, Volume 263, Issue 1, pp 12-21.
  5. Dai M, Zhao Y, Ma Q, Hu Y, Hedden P, Zhang Q, Zhou DX (2007a) The rice YABBY1 gene is involved in the feedback regulation of gibberellin metabolism. Plant Physiol 144:121–133.
  6. Alabadi D, Gil J, Blazquez MA, Garcia-Martinez JL (2004) Gibberellins repress photomorphogenesis in darkness. Plant Physiol 134:1050–1057.
  7. Kaneko M, Itoh H, Inukai Y, Sakamoto T, Ueguchi-Tanaka M, Ashikari M, Matsuoka M (2003) Where do gibberellin biosynthesis and gibberellin signalling occur in rice plants? Plant J 35:104–115.

Structured Information