Difference between revisions of "Os11g0592200"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(5 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os11g0592200''''' was reported as '''''OsPR4a''''' in 2009 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
* '''''Os11g0592200''''' '''<=>''' '''''OsPR4,OsPR4a,PR4a,OsPR-4'''''
 
===Function===
 
===Function===
Please input function information here.
+
* '''''PR4''''' proteins constitute a pathogenesis-related (PR) protein family with a conserved BARWIN domain.
 +
* The rice PR4 genes are also involved in abiotic stress responses and tolerance in addition to their responsiveness to pathogen attacks.
 +
 
 +
===Phenotypic analysis===
 +
* Transgenic rice with overexpression of '''''OsPR4a''''' showed enhanced tolerance to drought at both seedling and reproductive stages..
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* OsPR4 genes showed diverse temporal–spatial expression patterns, and their expressions are responsive to Magnaporthe grisea infection. Interestingly, the OsPR4 genes are also responsive to abiotic stresses.
 +
* Their expression levels were strongly induced by at least one of the stress treatments including drought, salt, cold, wounding, heat shock, and ultraviolet.
 +
* The transcript levels of OsPR4 genes were also induced by some phytohormones such as abscisic acid and jasmonic acid.
 +
<br>
 +
[[File:232-Os11g0592200.png|center|thumb|727px|'''Figure 4. (SnapShot)''' ''Expression level of OsPR4 genes in various tissues or organs. (A) Expression levels examined by quantitative real-time RT-PCR.<ref name="ref1" />.'']]
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The PR4 genes are located in tandem on chromosome 11 and constitute a gene cluster with high sequence similarity to each other.
 +
* The OsPR4 proteins have high sequence similarity to reported PR4 proteins from monocotyledonous species and are predicted to be class II PR4 proteins.
 +
* Distinct diversification of plant PR4 proteins exists between monocotyledonous and dicotyledonous plants.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China
 
+
* College of Plant Science and Technology, Huazhong Agricultural University, Wuhan 430070, China
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
 +
Wang N, Xiao B, Xiong L. Identification of a cluster of PR4-like genes
 +
involved in stress responses in rice. J Plant Physiol. 2011 Dec
 +
15;168(18):2212-24. doi: 10.1016/j.jplph.2011.07.013. PubMed PMID: 21955397.
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
GeneName = Os11g0592200|
 
Description = Similar to Chitin-binding allergen Bra r 2 (Fragments)|
 
Version = NM_001074722.1 GI:115486092 GeneID:4350823|
 
Length = 869 bp|
 
Definition = Oryza sativa Japonica Group Os11g0592200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:24354046..24354914|
 
CDS = 24354266..24354538,24354624..24354791|
 
GCID = <gbrowseImage1>
 
name=NC_008404:24354046..24354914
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:24354046..24354914
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggggatcaccggatctcgagcactcatggtggtggcgctcctctgcgctgccgcggccatgactgctgcacaagaagcatccaacgtgcgagccacgtatcattattacaacccacaacagaacaactgggacctgaacaaagtgagcgcatattgtgccacatgggatgccaacaaaccgttgtcttggcgccagaagtatggatggaccgccttctgtggacctgctggtcctaggggccgagactcgtgtggcaagtgtatccaggtgaagaaccggggaacaggtgcgacaataattgcgaggattgttgaccaatgcagcaatggtgggttggatctggactacgagaccatcttcaagaagatcgacacagatggtcgtggctaccagatgggtcacctccaggtcgattacaagttcgtcaattgttga</cdnaseq>|
 
AA = <aaseq>MAGITGSRALMVVALLCAAAAMTAAQEASNVRATYHYYNPQQNN                    WDLNKVSAYCATWDANKPLSWRQKYGWTAFCGPAGPRGRDSCGKCIQVKNRGTGATII                    ARIVDQCSNGGLDLDYETIFKKIDTDGRGYQMGHLQVDYKFVNC</aaseq>|
 
DNA = <dnaseqindica>221..493#579..746#cccatctgcaacagagaaagattgtgccacagtacaaactacctcattctccatcaggtgcacaatagaagaaactaaggtaagcactacattggcacccattcacccaagatccctatttctctcttccaaatcttcctctagcatgaagataagattgtacttatgataacgaattatctttttatttatacacatgaatatttagattctcaaagtgatggcggggatcaccggatctcgagcactcatggtggtggcgctcctctgcgctgccgcggccatgactgctgcacaagaagcatccaacgtgcgagccacgtatcattattacaacccacaacagaacaactgggacctgaacaaagtgagcgcatattgtgccacatgggatgccaacaaaccgttgtcttggcgccagaagtatggatggaccgccttctgtggacctgctggtcctaggggccgagactcgtgtggcaagtgtatccaggtattaaaattttcttcacattgacaaccgatttgtacttcaacattaaactgagtcgcttaaggatggtgtgctaaatttgtaggtgaagaaccggggaacaggtgcgacaataattgcgaggattgttgaccaatgcagcaatggtgggttggatctggactacgagaccatcttcaagaagatcgacacagatggtcgtggctaccagatgggtcacctccaggtcgattacaagttcgtcaattgttgatttggtcatgcctctttgcatgatcatatactggaataagaaatatatggtgttatacaataagatggaagaggttggcactctgtaatcatgctgaataatgaataaacgaaattacagttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074722.1 RefSeq:Os11g0592200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 

Latest revision as of 01:56, 15 February 2017

The rice Os11g0592200 was reported as OsPR4a in 2009 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os11g0592200 <=> OsPR4,OsPR4a,PR4a,OsPR-4

Function

  • PR4 proteins constitute a pathogenesis-related (PR) protein family with a conserved BARWIN domain.
  • The rice PR4 genes are also involved in abiotic stress responses and tolerance in addition to their responsiveness to pathogen attacks.

Phenotypic analysis

  • Transgenic rice with overexpression of OsPR4a showed enhanced tolerance to drought at both seedling and reproductive stages..

Expression

  • OsPR4 genes showed diverse temporal–spatial expression patterns, and their expressions are responsive to Magnaporthe grisea infection. Interestingly, the OsPR4 genes are also responsive to abiotic stresses.
  • Their expression levels were strongly induced by at least one of the stress treatments including drought, salt, cold, wounding, heat shock, and ultraviolet.
  • The transcript levels of OsPR4 genes were also induced by some phytohormones such as abscisic acid and jasmonic acid.


Figure 4. (SnapShot) Expression level of OsPR4 genes in various tissues or organs. (A) Expression levels examined by quantitative real-time RT-PCR.[1].

Evolution

  • The PR4 genes are located in tandem on chromosome 11 and constitute a gene cluster with high sequence similarity to each other.
  • The OsPR4 proteins have high sequence similarity to reported PR4 proteins from monocotyledonous species and are predicted to be class II PR4 proteins.
  • Distinct diversification of plant PR4 proteins exists between monocotyledonous and dicotyledonous plants.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China
  • College of Plant Science and Technology, Huazhong Agricultural University, Wuhan 430070, China

References

  1. 1.0 1.1 Wang N, Xiao B, Xiong L. Identification of a cluster of PR4-like genes involved in stress responses in rice. J Plant Physiol. 2011 Dec 15;168(18):2212-24. doi: 10.1016/j.jplph.2011.07.013. PubMed PMID: 21955397.

Structured Information