Difference between revisions of "Os11g0592100"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os11g0592100| Description = Similar to Barwin| Version = NM_001074721.1 GI:115486090 GeneID:4350822| Length = 1420 bp| Definition = Oryza sativ...")
 
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os11g0592100''''' was reported as '''''OsPR4b''''' in 2011 <ref name="ref1" /> by researchers from China.  
GeneName = Os11g0592100|
 
Description = Similar to Barwin|
 
Version = NM_001074721.1 GI:115486090 GeneID:4350822|
 
Length = 1420 bp|
 
Definition = Oryza sativa Japonica Group Os11g0592100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
* '''''Os11g0592200''''' '''<=>''' '''''OsPR4b,PR4B'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
* '''''PR4''''' proteins constitute a pathogenesis-related (PR) protein family with a conserved BARWIN domain.
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
+
* The rice PR4 genes are also involved in abiotic stress responses and tolerance in addition to their responsiveness to pathogen attacks.
AP = Chromosome 11:24348533..24349952|
+
 
CDS = 24348596..24348877,24349568..24349744|
+
===Phenotypic analysis===
GCID = <gbrowseImage1>
+
* Transgenic rice with overexpression of '''''OsPR4a''''' showed enhanced tolerance to drought at both seedling and reproductive stages..
name=NC_008404:24348533..24349952
+
 
source=RiceChromosome11
+
===Expression===
preset=GeneLocation
+
* OsPR4 genes showed diverse temporal–spatial expression patterns, and their expressions are responsive to Magnaporthe grisea infection. Interestingly, the OsPR4 genes are also responsive to abiotic stresses.  
</gbrowseImage1>|
+
* Their expression levels were strongly induced by at least one of the stress treatments including drought, salt, cold, wounding, heat shock, and ultraviolet.  
GSID = <gbrowseImage2>
+
* The transcript levels of OsPR4 genes were also induced by some phytohormones such as abscisic acid and jasmonic acid.
name=NC_008404:24348533..24349952
+
<br>
source=RiceChromosome11
+
[[File:232-Os11g0592200.png|center|thumb|727px|'''Figure 4. (SnapShot)''' ''Expression level of OsPR4 genes in various tissues or organs. (A) Expression levels examined by quantitative real-time RT-PCR.<ref name="ref1" />.'']]
preset=GeneLocation
+
 
</gbrowseImage2>|
+
===Evolution===
CDNA = <cdnaseq>atgatggtcatggcgatgatgagaagggtggtgatggtggtggcggtgctgtgtgcggtagcaactatggccatggcacaagaggcgtccaacgtgcgtgccacgtaccactactaccgtccggcggaaaacaattgggatttgggggccccggccgttagcgcgtactgtgccacgtgggatgctgacaagccgcttgaatggcgccagaagtatggatggaccgccttctgtgggcccgttggtcccactggtcaggatgcatgtggcaaatgtctctcggtgacgaacacggcgacaggggatcagatcacggcgaggatcgtggaccagtgcgccaatggggggctggatttagactgggacaccgtcttctccaagatcgacagcgacggtcaaggctaccagaatggccacctcatcgtcgactaccagttcgtcgactgcggcgataactag</cdnaseq>|
+
* The PR4 genes are located in tandem on chromosome 11 and constitute a gene cluster with high sequence similarity to each other.
AA = <aaseq>MMVMAMMRRVVMVVAVLCAVATMAMAQEASNVRATYHYYRPAEN                    NWDLGAPAVSAYCATWDADKPLEWRQKYGWTAFCGPVGPTGQDACGKCLSVTNTATGD                    QITARIVDQCANGGLDLDWDTVFSKIDSDGQGYQNGHLIVDYQFVDCGDN</aaseq>|
+
* The OsPR4 proteins have high sequence similarity to reported PR4 proteins from monocotyledonous species and are predicted to be class II PR4 proteins.
DNA = <dnaseqindica>64..345#1036..1212#atttcactagcatctagcaagtgcacaacacatctataaatcgtagtaaccaccttaggtgagatgatggtcatggcgatgatgagaagggtggtgatggtggtggcggtgctgtgtgcggtagcaactatggccatggcacaagaggcgtccaacgtgcgtgccacgtaccactactaccgtccggcggaaaacaattgggatttgggggccccggccgttagcgcgtactgtgccacgtgggatgctgacaagccgcttgaatggcgccagaagtatggatggaccgccttctgtgggcccgttggtcccactggtcaggatgcatgtggcaaatgtctctcggtaagaatgttttttttctttcttgcgttgagaaatgtaatacatattagatatcgagacaagcttataactttgaccattgtttttttttaaagtatatcactacaaaattagcaccttatgaaagtattttcaaataaaacttatgatgataaaatccaacttgtaaaactagttttacgatataatctacttagtatccccctcttacataacttacaccgattttaactacacgtcgtttcttaaaagatatttgctctggtccaacaaaaagtatttcaagataccagtatctcatggtaccaagatccaacgatcggaaacgatttggtaccatgaggtaccggtacctcgaggtacttttcgttggaccgtagcaaatctcttcttaaaaatctataaaaaaaattaaacgatatcgtattatcaaattaatttgcatgcaagtataattatactactcgcattcataaaaatatataatttaaaagttgtattggttaaaagtaaaatcacattggtcaatgaccaatgatgtcaagtaaaagggaaggctgagggtacaatcgaagggagtaattaaatgatgatatataacaaacttatctgtgacaggagagagtaaacaataaaattacacatgatcccccaagatatatgaccatggagtgtgtgtaatatttgcaggtgacgaacacggcgacaggggatcagatcacggcgaggatcgtggaccagtgcgccaatggggggctggatttagactgggacaccgtcttctccaagatcgacagcgacggtcaaggctaccagaatggccacctcatcgtcgactaccagttcgtcgactgcggcgataactagcagctaattaaccactcttataaacttccctacatatatatacacatttcggacagaggagtaattaatatatctctgcctgatgaatgaataaagtggctggtgaataattgtgatgctaggctgctgtagatcgatccgtttacacatgctcgaagtatcaataaaattgtgtggaaatgtgatggatttctgtggctaaaagcct</dnaseqindica>|
+
* Distinct diversification of plant PR4 proteins exists between monocotyledonous and dicotyledonous plants.
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074721.1 RefSeq:Os11g0592100]|
+
 
}}
+
You can also add sub-section(s) at will.
[[Category:Genes]]
+
 
[[Category:Japonica mRNA]]
+
==Labs working on this gene==
[[Category:Oryza Sativa Japonica Group]]
+
* National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China
[[Category:Japonica Genes]]
+
* College of Plant Science and Technology, Huazhong Agricultural University, Wuhan 430070, China
[[Category:Japonica Chromosome 11]]
+
==References==
[[Category:Chromosome 11]]
+
<references>
 +
* <ref name="ref1">
 +
Wang N, Xiao B, Xiong L. Identification of a cluster of PR4-like genes
 +
involved in stress responses in rice. J Plant Physiol. 2011 Dec
 +
15;168(18):2212-24. doi: 10.1016/j.jplph.2011.07.013. PubMed PMID: 21955397.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]

Latest revision as of 02:05, 15 February 2017

The rice Os11g0592100 was reported as OsPR4b in 2011 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os11g0592200 <=> OsPR4b,PR4B

Function

  • PR4 proteins constitute a pathogenesis-related (PR) protein family with a conserved BARWIN domain.
  • The rice PR4 genes are also involved in abiotic stress responses and tolerance in addition to their responsiveness to pathogen attacks.

Phenotypic analysis

  • Transgenic rice with overexpression of OsPR4a showed enhanced tolerance to drought at both seedling and reproductive stages..

Expression

  • OsPR4 genes showed diverse temporal–spatial expression patterns, and their expressions are responsive to Magnaporthe grisea infection. Interestingly, the OsPR4 genes are also responsive to abiotic stresses.
  • Their expression levels were strongly induced by at least one of the stress treatments including drought, salt, cold, wounding, heat shock, and ultraviolet.
  • The transcript levels of OsPR4 genes were also induced by some phytohormones such as abscisic acid and jasmonic acid.


Figure 4. (SnapShot) Expression level of OsPR4 genes in various tissues or organs. (A) Expression levels examined by quantitative real-time RT-PCR.[1].

Evolution

  • The PR4 genes are located in tandem on chromosome 11 and constitute a gene cluster with high sequence similarity to each other.
  • The OsPR4 proteins have high sequence similarity to reported PR4 proteins from monocotyledonous species and are predicted to be class II PR4 proteins.
  • Distinct diversification of plant PR4 proteins exists between monocotyledonous and dicotyledonous plants.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China
  • College of Plant Science and Technology, Huazhong Agricultural University, Wuhan 430070, China

References

  1. 1.0 1.1 Wang N, Xiao B, Xiong L. Identification of a cluster of PR4-like genes involved in stress responses in rice. J Plant Physiol. 2011 Dec 15;168(18):2212-24. doi: 10.1016/j.jplph.2011.07.013. PubMed PMID: 21955397.

Structured Information