Difference between revisions of "Os02g0531600"

From RiceWiki
Jump to: navigation, search
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0531600''''' was reported as '''''RCN2''''' and '''''DP2''''' in 2002 <ref name="ref1" /> and 2014 <ref name="ref2" /> by researchers from Japan and China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:94-Os02g0531600-1.png|right|thumb|427px|'''Figure 1.''' ''Morphological characterization of the wild type and dp2 mutant.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os02g0531600''''' '''''<=>''''' '''''OsRCN2,OsDP2''''','''''RCN2,DP2'''''
 
===Function===
 
===Function===
Please input function information here.
+
*Overexpression of '''''RCN1''''' and '''''RCN2''''' retarded the transition from vegetative to reproductive development in the SAM of rice
  
===Expression===
+
===Phenotypic analysis===
Please input expression information here.
+
* A dense panicle mutant ('''''dp2''''') derived from the Oryza sativa ssp. japonica cultivar Nipponbare through ethyl methane sulfonate mutagenesis was used in present study.
 
+
* The dp2 mutant did not exhibit a visibly abnormal phenotype during early vegetative growth stages compared to the wild type. After completely development, the panicle of the dp2 mutant became very dense in appearance, which was significantly different from the panicle of the wild type
===Evolution===
+
* Compared to the wild type, the panicle of '''''dp2''''' mutant exhibited more branches and denser grains. Further more, the number of spikelets per panicle, number of primary branches and secondary branches of dp2 mutant were significantly increased while the panicle length, and 1,000-grain weight were significantly decreased.
Please input evolution information here.
+
* The results from the genetic analysis indicated that the dense panicle phenotype was controlled by a single dominance nuclear gene.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Nara Institute of Science and Technology, Takayama 8916-5, Ikoma, Nara 630-0101, Japan
 +
* CREST, Japan Science and Technology Corporation, 4-1-8, Honcyo, Kawaguchi, Saitama 332-0012, Japan
 +
* Department of Agronomy, Zhejiang University, Hangzhou, China
 +
* Agricultural Experiment Station, Zhejiang University, Hangzhou, China
 +
* Department of Horticulture, Zhejiang A&F University, Linan, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Nakagawa, Mayu, Ko Shimamoto, and Junko Kyozuka. "Overexpression of RCN1 and RCN2, rice TERMINAL FLOWER 1/CENTRORADIALIS homologs, confers delay of phase transition and altered panicle morphology in rice." The Plant Journal 29.6 (2002): 743-750.
 +
</ref>
 +
* <ref name="ref2">
 +
Yang, Yunlong, et al. "Morphological characteristics and gene mapping of a dense panicle (dp2) mutant in rice (Oryza sativa L.)." Genes & Genomics 36.3 (2014): 313-319.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0531600|
 
Description = PEBP family protein|
 
Version = NM_001186077.1 GI:297721286 GeneID:9266285|
 
Length = 1165 bp|
 
Definition = Oryza sativa Japonica Group Os02g0531600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:20425494..20426658|
 
CDS = 20425494..20425711,20425977..20426017,20426279..20426340,20426458..20426658|
 
GCID = <gbrowseImage1>
 
name=NC_008395:20425494..20426658
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:20425494..20426658
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcgagggtgctggagcctctcattgtggggaaggtgatcggcgaggtgctggacaacttcaaccccacggtgaagatgacggccacctacggcgccaacaagcaggtgttcaacggccacgagttcttcccctccgccgtcgccggcaagccgcgcgtcgaggtccagggcggcgacctcaggtccttcttcacattggtgatgactgaccctgatgtgccagggcctagtgatccatacctgagggagcatcttcactggattgttactgatattcctgggactactgatgcctcttttgggagggaggtggtgagctacgagagcccgcggccaaacatcggcatccacaggttcatcctggtgctgttccggcagaagcgccggcaggcggtgagcccgccgccgtcgagggaccgcttcagcacccgccagttcgccgaggacaacgacctcggcctccccgtcgccgccgtctacttcaacgcgcagcgcgagaccgccgctcgccgccgctaa</cdnaseq>|
 
AA = <aaseq>MSRVLEPLIVGKVIGEVLDNFNPTVKMTATYGANKQVFNGHEFF                    PSAVAGKPRVEVQGGDLRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFG                    REVVSYESPRPNIGIHRFILVLFRQKRRQAVSPPPSRDRFSTRQFAEDNDLGLPVAAV                    YFNAQRETAARRR</aaseq>|
 
DNA = <dnaseqindica>948..1165#642..682#319..380#1..201#atgtcgagggtgctggagcctctcattgtggggaaggtgatcggcgaggtgctggacaacttcaaccccacggtgaagatgacggccacctacggcgccaacaagcaggtgttcaacggccacgagttcttcccctccgccgtcgccggcaagccgcgcgtcgaggtccagggcggcgacctcaggtccttcttcacattggtgcgtatgcctgtctcatctgctgctggattcatcagactatcgcacatctatactgtaatatgtatgtgtccattatgtgctaattgatcctttgtacttgtgtgcttaattcaggtgatgactgaccctgatgtgccagggcctagtgatccatacctgagggagcatcttcactggtaatttatactactacctgtacaagttaatattgctcggtcttattcaagttgattagacattattaggtacaagtgtcacctacatagccagacaaatttgtataggtggtcactggtcacgccatgattgattgcttgcaaagattctgtcatgcatgctgttaatcattgtttttccagattaattttcaatcaatgcattctatagagtatgtgtagctaatcaggtgaccttttgattggaccaccttgctgcaggattgttactgatattcctgggactactgatgcctcttttggtaagcctttcccctgtacatcctgctttagtctttgccagttttgaaccttgatgagaattgactgatcagagagatccagagtgaacaattagccacaatacaaggtcaattaatttgtggtaaactggtaatgtagtaactattttttttttaaaaaaaatatgtactaattaatcaaaacaatatttatttgtcttatctaggttatagctttctctgatctctctataattaattttgtgtgtgatcaatggtgatgcagggagggaggtggtgagctacgagagcccgcggccaaacatcggcatccacaggttcatcctggtgctgttccggcagaagcgccggcaggcggtgagcccgccgccgtcgagggaccgcttcagcacccgccagttcgccgaggacaacgacctcggcctccccgtcgccgccgtctacttcaacgcgcagcgcgagaccgccgctcgccgccgctaa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186077.1 RefSeq:Os02g0531600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 01:06, 17 February 2017

The rice Os02g0531600 was reported as RCN2 and DP2 in 2002 [1] and 2014 [2] by researchers from Japan and China.

Annotated Information

Figure 1. Morphological characterization of the wild type and dp2 mutant.[1].

Gene Symbol

  • Os02g0531600 <=> OsRCN2,OsDP2,RCN2,DP2

Function

  • Overexpression of RCN1 and RCN2 retarded the transition from vegetative to reproductive development in the SAM of rice

Phenotypic analysis

  • A dense panicle mutant (dp2) derived from the Oryza sativa ssp. japonica cultivar Nipponbare through ethyl methane sulfonate mutagenesis was used in present study.
  • The dp2 mutant did not exhibit a visibly abnormal phenotype during early vegetative growth stages compared to the wild type. After completely development, the panicle of the dp2 mutant became very dense in appearance, which was significantly different from the panicle of the wild type
  • Compared to the wild type, the panicle of dp2 mutant exhibited more branches and denser grains. Further more, the number of spikelets per panicle, number of primary branches and secondary branches of dp2 mutant were significantly increased while the panicle length, and 1,000-grain weight were significantly decreased.
  • The results from the genetic analysis indicated that the dense panicle phenotype was controlled by a single dominance nuclear gene.

You can also add sub-section(s) at will.

Labs working on this gene

  • Nara Institute of Science and Technology, Takayama 8916-5, Ikoma, Nara 630-0101, Japan
  • CREST, Japan Science and Technology Corporation, 4-1-8, Honcyo, Kawaguchi, Saitama 332-0012, Japan
  • Department of Agronomy, Zhejiang University, Hangzhou, China
  • Agricultural Experiment Station, Zhejiang University, Hangzhou, China
  • Department of Horticulture, Zhejiang A&F University, Linan, China

References

  1. 1.0 1.1 Nakagawa, Mayu, Ko Shimamoto, and Junko Kyozuka. "Overexpression of RCN1 and RCN2, rice TERMINAL FLOWER 1/CENTRORADIALIS homologs, confers delay of phase transition and altered panicle morphology in rice." The Plant Journal 29.6 (2002): 743-750.
  2. Yang, Yunlong, et al. "Morphological characteristics and gene mapping of a dense panicle (dp2) mutant in rice (Oryza sativa L.)." Genes & Genomics 36.3 (2014): 313-319.

Structured Information