Difference between revisions of "Os11g0152500"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os11g0152500''''' was reported as '''''RCN1''''' in 2002 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os11g0152500''''' '''<=>''' '''''RCN1,OsRCN1'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* TERMINAL FLOWER 1 (TFL1)/CENTRORADIALIS (CEN)-like genes play important roles in determining plant architecture, mainly by controlling the timing of phase transition.
 
+
* Rice may have a pathway that can respond to the overexpressed TFL1/CEN-like functions, and the molecular mechanisms controlling the phase transition of meristems are conserved between grass and dicot species, at least to some extent.
===Expression===
 
Please input expression information here.
 
  
===Evolution===
+
===Phenotypic analysis===
Please input evolution information here.
+
* In 35S::RCN1 and 35S::RCN2 transgenic rice plants, the delay of transition to the reproductive phase was observed. The transgenic rice plants exhibited a more branched, denser panicle morphology. Detailed observation of the panicle structure revealed that the phase change from the branch shoot to the  ̄oral meristem state was also delayed, leading to the generation of higher-order panicle branches.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Nara Institute of Science and Technology, Takayama 8916-5, Ikoma, Nara 630-0101, Japan
 +
* CREST, Japan Science and Technology Corporation, 4-1-8, Honcyo, Kawaguchi, Saitama 332-0012, Japan
 +
 
 +
<references>
 +
* <ref name="ref1">
 +
Nakagawa M, Shimamoto K, Kyozuka J. Overexpression of RCN1 and RCN2, rice
 +
TERMINAL FLOWER 1/CENTRORADIALIS homologs, confers delay of phase transition and
 +
altered panicle morphology in rice. Plant J. 2002 Mar;29(6):743-50. PubMed PMID:
 +
12148532.
 +
</references>
  
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
GeneName = Os11g0152500|
 
Description = PEBP family protein|
 
Version = NM_001072303.1 GI:115484218 GeneID:4349798|
 
Length = 1331 bp|
 
Definition = Oryza sativa Japonica Group Os11g0152500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:2434690..2436020|
 
CDS = 2435025..2435242,2435339..2435379,2435593..2435654,2435727..2435927|
 
GCID = <gbrowseImage1>
 
name=NC_008404:2434690..2436020
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:2434690..2436020
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtctaggtctgtggagcctcttgttgtagggcgcgtgattggggaagttcttgatacctttaacccatgcatgaagatgatagtgacctataactccaacaagcttgtatttaatggtcatgagctctacccatcagcagttgtgtctaaaccaagagttgaggtccaagggggtgacctgcgatctttcttcacattggttatgacagacccagatgtgccaggaccaagtgatccttatctaagggagcaccttcattggattgttactgatatacctgggacaacggatgcttcttttggacgcgaggtcataagctatgagagtccaaagccgaacattggcatccataggttcatttttgtgctcttcaagcagaagcgcaggcaaactgtaattgtgccatccttcagggaccatttcaacacccgccggttcgccgaggagaatgatcttggccttcctgtggctgctgtctacttcaatgcccagagagagactgcagccaggaggcgctga</cdnaseq>|
 
AA = <aaseq>MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELY                    PSAVVSKPRVEVQGGDLRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFG                    REVISYESPKPNIGIHRFIFVLFKQKRRQTVIVPSFRDHFNTRRFAEENDLGLPVAAV                    YFNAQRETAARRR</aaseq>|
 
DNA = <dnaseqindica>779..996#642..682#367..428#94..294#aatcagcccacagctcaccgaagtgcattagctcaccacgactagctagagcactcattggtgtgcaaaatattactgtctgctcctctaaacatgtctaggtctgtggagcctcttgttgtagggcgcgtgattggggaagttcttgatacctttaacccatgcatgaagatgatagtgacctataactccaacaagcttgtatttaatggtcatgagctctacccatcagcagttgtgtctaaaccaagagttgaggtccaagggggtgacctgcgatctttcttcacattggtgcggagcactcaacttcatagttggtttacgatttttttccctggttaaccataactcctcatgtttcaggttatgacagacccagatgtgccaggaccaagtgatccttatctaagggagcaccttcattggtaaccaaccatgaacatttgtatctaaatactatatatttgtttcttgtgggtggttaccgattagctagacatgttagttatgtttctagggaagataggacaattactttagctttcatatgcatacaaacaacacataatctgactagtcttaacatgaatagtaatgtggctaaattatcagcaaatctcaccttaacatttacgcaggattgttactgatatacctgggacaacggatgcttcttttggtaggtccttcctctaatttgtgtcagtttttttttccatcttattcattgagtttctccttgtgaataaacaactgtaccactttccgattgaaggacgcgaggtcataagctatgagagtccaaagccgaacattggcatccataggttcatttttgtgctcttcaagcagaagcgcaggcaaactgtaattgtgccatccttcagggaccatttcaacacccgccggttcgccgaggagaatgatcttggccttcctgtggctgctgtctacttcaatgcccagagagagactgcagccaggaggcgctgagaaatgcagctccaattgtcccaaaattacgattctctgaaatcaaaccttttctgccatattactttctcatgaatcaacgttcttctgctacatcagcagccagtatatctgcgaataaaccagatgcattttgcagcatgtattagtattagatttctttccgtatcaagaacatattagtggattattttgtaagcagtaagattgatagccatgttggcaaattccagtgcactaatatgtaaaccacgttattattaatgtttttaagtcatgtataagccaattcatgctggtggacaaacccaactggtagaaagggctttttatct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072303.1 RefSeq:Os11g0152500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 

Latest revision as of 01:11, 17 February 2017

The rice Os11g0152500 was reported as RCN1 in 2002 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os11g0152500 <=> RCN1,OsRCN1

Function

  • TERMINAL FLOWER 1 (TFL1)/CENTRORADIALIS (CEN)-like genes play important roles in determining plant architecture, mainly by controlling the timing of phase transition.
  • Rice may have a pathway that can respond to the overexpressed TFL1/CEN-like functions, and the molecular mechanisms controlling the phase transition of meristems are conserved between grass and dicot species, at least to some extent.

Phenotypic analysis

  • In 35S::RCN1 and 35S::RCN2 transgenic rice plants, the delay of transition to the reproductive phase was observed. The transgenic rice plants exhibited a more branched, denser panicle morphology. Detailed observation of the panicle structure revealed that the phase change from the branch shoot to the ̄oral meristem state was also delayed, leading to the generation of higher-order panicle branches.

You can also add sub-section(s) at will.

Labs working on this gene

  • Nara Institute of Science and Technology, Takayama 8916-5, Ikoma, Nara 630-0101, Japan
  • CREST, Japan Science and Technology Corporation, 4-1-8, Honcyo, Kawaguchi, Saitama 332-0012, Japan
  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1


Structured Information