Difference between revisions of "Os11g0152500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os11g0152500| Description = PEBP family protein| Version = NM_001072303.1 GI:115484218 GeneID:4349798| Length = 1331 bp| Definition = Oryza sat...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os11g0152500''''' was reported as '''''RCN1''''' in 2002 <ref name="ref1" /> by researchers from Japan.  
GeneName = Os11g0152500|
 
Description = PEBP family protein|
 
Version = NM_001072303.1 GI:115484218 GeneID:4349798|
 
Length = 1331 bp|
 
Definition = Oryza sativa Japonica Group Os11g0152500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os11g0152500''''' '''<=>''' '''''RCN1,OsRCN1'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
+
* TERMINAL FLOWER 1 (TFL1)/CENTRORADIALIS (CEN)-like genes play important roles in determining plant architecture, mainly by controlling the timing of phase transition.
AP = Chromosome 11:2434690..2436020|
+
* Rice may have a pathway that can respond to the overexpressed TFL1/CEN-like functions, and the molecular mechanisms controlling the phase transition of meristems are conserved between grass and dicot species, at least to some extent.
CDS = 2435025..2435242,2435339..2435379,2435593..2435654,2435727..2435927|
+
 
GCID = <gbrowseImage1>
+
===Phenotypic analysis===
name=NC_008404:2434690..2436020
+
* In 35S::RCN1 and 35S::RCN2 transgenic rice plants, the delay of transition to the reproductive phase was observed. The transgenic rice plants exhibited a more branched, denser panicle morphology. Detailed observation of the panicle structure revealed that the phase change from the branch shoot to the  ̄oral meristem state was also delayed, leading to the generation of higher-order panicle branches.
source=RiceChromosome11
+
 
preset=GeneLocation
+
You can also add sub-section(s) at will.
</gbrowseImage1>|
+
 
GSID = <gbrowseImage2>
+
==Labs working on this gene==
name=NC_008404:2434690..2436020
+
* Nara Institute of Science and Technology, Takayama 8916-5, Ikoma, Nara 630-0101, Japan
source=RiceChromosome11
+
* CREST, Japan Science and Technology Corporation, 4-1-8, Honcyo, Kawaguchi, Saitama 332-0012, Japan
preset=GeneLocation
+
 
</gbrowseImage2>|
+
<references>
CDNA = <cdnaseq>atgtctaggtctgtggagcctcttgttgtagggcgcgtgattggggaagttcttgatacctttaacccatgcatgaagatgatagtgacctataactccaacaagcttgtatttaatggtcatgagctctacccatcagcagttgtgtctaaaccaagagttgaggtccaagggggtgacctgcgatctttcttcacattggttatgacagacccagatgtgccaggaccaagtgatccttatctaagggagcaccttcattggattgttactgatatacctgggacaacggatgcttcttttggacgcgaggtcataagctatgagagtccaaagccgaacattggcatccataggttcatttttgtgctcttcaagcagaagcgcaggcaaactgtaattgtgccatccttcagggaccatttcaacacccgccggttcgccgaggagaatgatcttggccttcctgtggctgctgtctacttcaatgcccagagagagactgcagccaggaggcgctga</cdnaseq>|
+
* <ref name="ref1">
AA = <aaseq>MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELY                    PSAVVSKPRVEVQGGDLRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFG                    REVISYESPKPNIGIHRFIFVLFKQKRRQTVIVPSFRDHFNTRRFAEENDLGLPVAAV                    YFNAQRETAARRR</aaseq>|
+
Nakagawa M, Shimamoto K, Kyozuka J. Overexpression of RCN1 and RCN2, rice
DNA = <dnaseqindica>779..996#642..682#367..428#94..294#aatcagcccacagctcaccgaagtgcattagctcaccacgactagctagagcactcattggtgtgcaaaatattactgtctgctcctctaaacatgtctaggtctgtggagcctcttgttgtagggcgcgtgattggggaagttcttgatacctttaacccatgcatgaagatgatagtgacctataactccaacaagcttgtatttaatggtcatgagctctacccatcagcagttgtgtctaaaccaagagttgaggtccaagggggtgacctgcgatctttcttcacattggtgcggagcactcaacttcatagttggtttacgatttttttccctggttaaccataactcctcatgtttcaggttatgacagacccagatgtgccaggaccaagtgatccttatctaagggagcaccttcattggtaaccaaccatgaacatttgtatctaaatactatatatttgtttcttgtgggtggttaccgattagctagacatgttagttatgtttctagggaagataggacaattactttagctttcatatgcatacaaacaacacataatctgactagtcttaacatgaatagtaatgtggctaaattatcagcaaatctcaccttaacatttacgcaggattgttactgatatacctgggacaacggatgcttcttttggtaggtccttcctctaatttgtgtcagtttttttttccatcttattcattgagtttctccttgtgaataaacaactgtaccactttccgattgaaggacgcgaggtcataagctatgagagtccaaagccgaacattggcatccataggttcatttttgtgctcttcaagcagaagcgcaggcaaactgtaattgtgccatccttcagggaccatttcaacacccgccggttcgccgaggagaatgatcttggccttcctgtggctgctgtctacttcaatgcccagagagagactgcagccaggaggcgctgagaaatgcagctccaattgtcccaaaattacgattctctgaaatcaaaccttttctgccatattactttctcatgaatcaacgttcttctgctacatcagcagccagtatatctgcgaataaaccagatgcattttgcagcatgtattagtattagatttctttccgtatcaagaacatattagtggattattttgtaagcagtaagattgatagccatgttggcaaattccagtgcactaatatgtaaaccacgttattattaatgtttttaagtcatgtataagccaattcatgctggtggacaaacccaactggtagaaagggctttttatct</dnaseqindica>|
+
TERMINAL FLOWER 1/CENTRORADIALIS homologs, confers delay of phase transition and
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072303.1 RefSeq:Os11g0152500]|
+
altered panicle morphology in rice. Plant J. 2002 Mar;29(6):743-50. PubMed PMID:
}}
+
12148532.
[[Category:Genes]]
+
</references>
[[Category:Japonica mRNA]]
+
 
[[Category:Oryza Sativa Japonica Group]]
+
 
[[Category:Japonica Genes]]
+
==Structured Information==
[[Category:Japonica Chromosome 11]]
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
[[Category:Chromosome 11]]
 

Latest revision as of 01:11, 17 February 2017

The rice Os11g0152500 was reported as RCN1 in 2002 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os11g0152500 <=> RCN1,OsRCN1

Function

  • TERMINAL FLOWER 1 (TFL1)/CENTRORADIALIS (CEN)-like genes play important roles in determining plant architecture, mainly by controlling the timing of phase transition.
  • Rice may have a pathway that can respond to the overexpressed TFL1/CEN-like functions, and the molecular mechanisms controlling the phase transition of meristems are conserved between grass and dicot species, at least to some extent.

Phenotypic analysis

  • In 35S::RCN1 and 35S::RCN2 transgenic rice plants, the delay of transition to the reproductive phase was observed. The transgenic rice plants exhibited a more branched, denser panicle morphology. Detailed observation of the panicle structure revealed that the phase change from the branch shoot to the ̄oral meristem state was also delayed, leading to the generation of higher-order panicle branches.

You can also add sub-section(s) at will.

Labs working on this gene

  • Nara Institute of Science and Technology, Takayama 8916-5, Ikoma, Nara 630-0101, Japan
  • CREST, Japan Science and Technology Corporation, 4-1-8, Honcyo, Kawaguchi, Saitama 332-0012, Japan
  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1


Structured Information