|
|
| (8 intermediate revisions by 4 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os10g0561400''''' was reported as '''''MYBS3''''' in 2010 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| − | OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice. | + | ===Gene Symbol=== |
| | + | *'''''Os10g0561400''''' '''<=>''' '''''MYBS3,OsMYBS3''''' |
| | ===Function=== | | ===Function=== |
| − | OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression. As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear. OsMYBS3 is most abundant in senescent leaves, in which sugars are depleted as a result of their transport to other tissues. OsMYBS3 may preventα-amylase genes from being induced by the low sugar level in senescent leaves, which would be a wasteful process in dying cells <ref name="refA" />. | + | * OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice. |
| | + | * OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression. |
| | + | * As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear. |
| | + | |
| | + | ===Phenotypic analysis=== |
| | + | * Transcription profiling of transgenic rice overexpressing or underexpressing MYBS3 led to the identification of many genes in the MYBS3-mediated cold signaling pathway. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | The open reading frames of OsMYBS1, OsMYBS2, and OsMYBS3 encode polypeptides of 306, 276, and 318 amino acid residues, respectively. The three OsMYBSs contain a highly conserved single DNA binding domain that is very similar to the DNA binding domains of other mammalian, Drosophila, and plant. OsMYBS3 is expressed in all tissues, with the highest level in senescent leaves. The levels of OsMYBS3 mRNAs are low in the presence of Suc but increase in the absence of Suc which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. OsMYBS3 is suppressed in the presence of Glc or GA but remains unchanged in the presence of abscisic acid. OsMYBS3 doesn't significantly enhance luciferase activity in the presence of Glc and repressed luciferase activity in the absence of Glc. OsMYBS3 may serve as a repressor, for transcription of the promoter containing SRS <ref name="refA" />. OsMYBS3 in rice are enhanced by ABA and abiotic stresses <ref name="refC" /> and cold stress conditions <ref name="refD"/>, respectively.OsMYBS3 transgenic rice plants acquire cold tolerance with no penalty in terms of yield under normal field conditions. In addition, OsMYBS3 in rice regulates the expression of cold-related genes such as WRKY77 and Glu decarboxylase, both of which contain a TATCCA element in their promoters <ref name="refD" />.
| + | * Expression of MYBS3 was found to be ubiquitous in all tissues in seedlings and mature plants and in cultured suspension cells of rice |
| − | | + | * Expression of MYBS3 Is Ubiquitous and Activated by Cold Stress |
| − | ===Evolution===
| |
| − | OsMYBS3 is rich in both Pro (19 of 166 amino acids, or 11%) and acidic amino acids (22 of 166 amino acids, or 13%). Some 1R-Myb proteins, including CCA1, OsMYBS3, and PSR1, are 30 to 40% identical in the Myb domain with each other and possess a SHAQK(Y/F)F motif<ref name="refE" />. It is not clear why OsMYBS2 and OsMYBS3 do not form homodimers by themselves and why the three Os-MYBSs do not form heterodimers with each other <ref name="refA" />. Barley HvMYBS3, rice OsMYBS3 and maize ZmMYBSt1 are probably orthologous, because, in addition to the 100% identity of their DBD, they share 84.6% and 80.9% identical residues, respectively, along their whole protein sequences (WPS) <ref name="refB" />. Sequence comparison of single MYB-like domain TFs, MYB-like domain proteins and StMYB1R-1<ref name="refE" />. [[File:Plant Physiol.jpg|Figure 1. Sequence comparison of single MYB-like domain TFs and StMYB1R-1. A, Phylogenetic analysis of StMYB1R-1. The phylogenic tree was constructed with the DNASTAR program (DNASTAR, Inc.) using the deduced amino acid sequence of StMYB1R-1 and other single MYB-like domain protein sequences. B, Amino acid sequence alignment of StMYB1R-1 and other single MYB-like domain proteins. Accession numbers are as follows: StMYB1R-1, ABB86258; At1g19000, BAH19529; At1g74840, BAH56970; AtCCA1, AAB40525; AtLHY, NP_00103092; GmMYB176, ABH02865; GmMYB177, ABH02866; LeMYB1, CAB65169; MYBSt1, AAB32591; OsMYBS1, AAN63152; OsMYBS2, AAN63153; OsMYBS3, AAN63154; PTLe00585.1, AAX95766; and Sb01g029020, XP_002464930<ref name="refE" />.]]
| |
| − | === Knowledge Extension ===
| |
| − | To determine whether OsMYBS gene expression was regulated by sugars, total RNA was isolated from rice suspension cells cultured in the presence or absence of Suc for 48h and subjected to gel blot analysis using OsMYBS-specific DNAs as probes. Figure 2 shows that the levels of OsMYBS1 and OsMYBS3 mRNAs were low in the presence of Suc (lanes 1 to 8) but increased in the absence of Suc (lanes 9 to 16), which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. By contrast, the levels of OsMYBS2 were higher in the presence than in the absence of Suc. Transient expression assays with barley half-seeds were used as a system to study the function of OsMYBSs in sugar and hormone regulation in later experiments. To determine whether OsMYBSs are expressed in barley aleurone cells, total RNA was isolated from barley half-seeds and subjected to gel blot analysis using OsMYBS-specific DNAs as probes. Figure 3C shows that all of these OsMYBSs were expressed in barley aleurone cells in the absence of Glc. The expression levels of OsMYBS1 and OsMYBS3 were suppressed in the presence of Glc or GA but remained unchanged in the presence of abscisic acid. The expression of OsMYBS2 was enhanced in the presence of Glc and slightly suppressed by abscisic acid treatment. <ref name="refA" /> [[File:Plant Cell-2002-Lu-1963-80.jpg|Figure 2. Each of the Three OsMYBS Genes Is a Single-Copy Gene in the Rice Genome. Rice genomic DNA was digested with EcoRI (E), HindIII (H), and PstI (P) and subjected to gel blot analysis. OsMYBS1, OsMYBS2, or OsMYBS3 gene-specific DNA was used as a probe for hybridization of each of the three blots, which were prepared in parallel. Molecular mass markers (in kb) are shown at left<ref name="refA" />.]]
| |
| − | | |
| | == References == | | == References == |
| | <references> | | <references> |
| − | <ref name="refA">Lu C A, Ho T D, Ho S L, et al. Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of α-amylase gene expression[J]. The Plant Cell Online, 2002, 14(8): 1963-1980.</ref> | + | * <ref name="ref1"> |
| − | <ref name="refB">Rubio‐Somoza I, Martinez M, Abraham Z, et al. Ternary complex formation between HvMYBS3 and other factors involved in transcriptional control in barley seeds[J]. The Plant Journal, 2006, 47(2): 269-281.</ref>
| + | Su CF, Wang YC, Hsieh TH, Lu CA, Tseng TH, Yu SM. A novel MYBS3-dependent |
| − | <ref name="refC">Liao Y, Zou HF, Wang HW, Zhang WK, Ma B, Zhang JS, Chen SY (2008) Soybean GmMYB76, GmMYB92, and GmMYB177 genes confer stress tolerance in transgenic Arabidopsis plants. Cell Res 18: 1047–1060.</ref>
| + | pathway confers cold tolerance in rice. Plant Physiol. 2010 May;153(1):145-58. |
| − | <ref name="refD">Su C F, Wang Y C, Hsieh T H, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice[J]. Plant physiology, 2010, 153(1): 145-158.
| + | doi: 10.1104/pp.110.153015. PubMed PMID: 20130099; PubMed Central PMCID: |
| | + | PMC2862423. |
| | + | |
| | </ref> | | </ref> |
| − | <ref name="refE">Yoshioka S, Taniguchi F, Miura K, et al. The novel Myb transcription factor LCR1 regulates the CO2-responsive gene Cah1, encoding a periplasmic carbonic anhydrase in Chlamydomonas reinhardtii[J]. The Plant Cell Online, 2004, 16(6): 1466-1477.</ref>
| |
| | </references> | | </references> |
| | + | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | *Engineering Research Center for Plant Biotechnology and Germplasm Utilization, Ministry of Education, State Key Laboratory of Hybrid Rice, College of Life Sciences,Wuhan University, Wuhan,China | + | * Institute of Biotechnology, National Cheng Kung University, Tainan 701, Taiwan, Republic of China (C.-F.S.); |
| − | *Institute of Crop Sciences/National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing, China | + | * Institute of Molecular Biology (Y.-C.W., S.-M.Y.) and Institute of Plant and Microbial Biology (T.-H.H.), Academia Sinica, Nankang, Taipei 115, Taiwan, Republic of China; Department of Life Science, |
| − | *Key Laboratory of Plant Resources, Institute of Botany, The Chinese Academy of Sciences, Beijing 100093, PR China
| + | * National Central University, Zhongli, Taoyuan County 320, Taiwan, Republic of China (C.-A.L.); |
| − | *Bio-crop Development Division, National Academy of Agricultural Science, Rural Development
| + | * Division of Biotechnology, Taiwan Agricultural Research Institute, Wu-Fong, Taichung County 413, Taiwan, Republic of China (T.-H.T.) |
| − | Administration, Suwon 441–857, Republic of Korea
| |
| − | *Institute of Biotechnology, National Cheng Kung University, Tainan 701, Taiwan, Republic of China | |
| − | *Department of Biology, Washington University, St. Louis, Missouri 63130
| |
| − | *Division of Integrated Life Science, Graduate School of Biostudies, Kyoto University, Oiwake-cho, Sakyo-ku, Kyoto, 606-8502, Japan | |
| | | | |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os10g0561400|
| |
| − | Description = Similar to Transcription factor MYBS3|
| |
| − | Version = NM_001071918.1 GI:115483431 GeneID:4349385|
| |
| − | Length = 8307 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os10g0561400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
| |
| − | AP = Chromosome 10:22583739..22592045|
| |
| − | CDS = 22584003..22584473,22584753..22584961,22588740..22588764|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008403:22583739..22592045
| |
| − | source=RiceChromosome10
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008403:22583739..22592045
| |
| − | source=RiceChromosome10
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgttattcgcgttggacgaggcaggtgttccttggactgaagaagaacaccggaggtttttgcttggattgcaaaagcttggcaaaggtgattggcgaggaatctctcgtaatttcgtggtctcaagaacacctactcaagtagccagtcatgctcagaaatattttatacgccaatccaatatgaccagaaggaaaagaaggtctagcctttttgacatggtgccagatgagtctatggaccttccaccacttcctggaggtcaagaaccagagacccaagtattaaatcaaccagcactacctccaccgagggaggaggaggaggtagattctatggagtcagatacttctgccgttgcagagagctcttccgcttctgctatcatgccagataatttgcagtcgacctatccagtgattgttccagcttatttctcgccctttttgcaattctcggttcctttctggcaaaatcagaaagatgaagatggtcctgtgcaagaaacacatgagattgtcaagcctgttccagttcattcaaagagcccaatcaacgttgatgagcttgttggcatgtcgaagctcagcataggagagtccaatcaagagacagtgtctacttctctttcattaaatctggtaggaggtcaaaatagacaatcagctttccatgcaaatccaccaacaagggcacaggcatga</cdnaseq>|
| |
| − | AA = <aaseq>MLFALDEAGVPWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRT PTQVASHAQKYFIRQSNMTRRKRRSSLFDMVPDESMDLPPLPGGQEPETQVLNQPALP PPREEEEVDSMESDTSAVAESSSASAIMPDNLQSTYPVIVPAYFSPFLQFSVPFWQNQ KDEDGPVQETHEIVKPVPVHSKSPINVDELVGMSKLSIGESNQETVSTSLSLNLVGGQ NRQSAFHANPPTRAQA</aaseq>|
| |
| − | DNA = <dnaseqindica>7573..8043#7085..7293#3282..3306#agaggcgcgcgtcgccgtcgggcggcggcgaagccggagatggcggggacgccggggaggcgccctccggcagccggctccgcgccgcagcggaatccgaccggaggcaggtagataagtatcctgctcctcttccctcgcgttccagctcgcgaagtccccgtttaatttgattttgtatgcgtttttgctgggtagggttatggtatgtactagggtgtgttcgttcggggatggcgactagttcttcgagctttcgccggaggggaagatggcggtgcggccctcggggaaagaggggtaaggatttttcagtgcttgcctcttgggctcgtggtgaactggtgatagcttggagtgtgaggggatcgtcgacaaccgtggcgtgtgcttcgattattgcttaatttgttcaggttacgcgcgactctgtcagccagatgtagttggagagccttttgtcatatcctcatactgcctgtagttcgagacaaaaatcatattttcgaatattttacttttttgggatggttgctacgatgcagttgagtggttcagttgtgattggtgattgtctgtgtaggatgcatcaagcggtatttctgatttgggcctctggaagatggatttgagtgatgatgtgtaccaattgctttctgaaggtacttgtctgcttcgccatttctcaacaactgataaatttgtcaaatgtaaccgttcatttttacttggacgttcatcattcagttgatttgatgtcctttccaagctttgcttcttaaaaggacaaaagaatatttctatatttgtccggccaaattatctttagaacactttccatcttgaaaggcgtcaatgaaactgtactgtgcaaatctgccataggcatttttgatttggtattgtgcaaacaactacagcattctagaactgtatcacaagttcacaacccactttctatcactcttgctcattgcacattcatatcttgtttcagagaactgtttactccactgttgttgcttatatttcccttcaagtttgggacctgattctgaattctttcagaacaatggtgcacgttactgctgatcagcactattcggtcaataatgcagtgcagtcataagtgcaccatttcaagtgtatttgttagttggtactaaatatctgtgcattacagtgtttatatgatactaaaactcttcatgccagaacatttttagtttagtaagaaaccataaggtccaaaatggttggttcagtgttcagactagcagctcggcaaaatcttcttactaatgtttcagattaattatattgctgccatatactgggtgcgtatgattgagaaaattaaatctattaggtaacataaatatggttggttcagtgttcagactagcatctcagcaaaatcttcttactaatgtttcagattaattatattgctgccatatactgggtgcgtatgattgagaaaattaaatctattaggtaacataaatataaggcgtgtaggcttctgggctctggagtaccgttgttttgtgcaatgttcaactgagttgtttttaaactagagaatgagatataaacagaaaacaaatcatgaatcttcttattctttttaatgaactgactgtgtttctttatcattgttgatccagccgagcaacttttttaagtttatcttttatttccatacatcttatctctttgttttattgaaatggatttgtttatcaattcaataccagtgaagcatatgaatctgatgatggaaactgttgcaacggcacattcggaatatgccaatatggaatggctacccttgcctgcaggtatgctatctttttcacaacttttaattcatcaagttctgttctttctttagattatcactcacgtaaacaatatatatccacctgttgatatggtcctgtactccagtgtcagtttttttatatataaaaaaagatatggtccagtcactgctgatggatcctaacttatattttattcgataatttgaagatatatgctagtatcttgcaagggatattttgtccaactgcatcaacaaaattaggcatcaagatttggatgttggtaagcacatcctctctctagatcggtgcaagtgcaacctccgtcttgaatcttgatgacattagatgagaatatctccacacgaaaataatataggccattgctcactcagttgcttacatactctgttttactttagattatgatgcctttctacttcaaataggtaaatactctttagtacagaatataaaaaaaaggtaatatctctgtaacaagcaagtcactgtcaaaattatcctaacaccttcaagtttttgctatttttattaactgcgcccttgattgatccgtgactgtcatttttctttgacgcgttccgtgatagtcatggcttaggattaccgtgcataagggataaaggtgcatgctgatcgattgccgactttttgagtgtttagccacgctttttcttaacttatcctctttggtccgttcaaccccatggatgcaattttaattagttgcgagcagaaagcatattgttggcttagataagctgtcactgtttcgtgcttgtagcaatatgataatacagaatgcagtagtagaccgacaacattgtcccccggttttacgagtggtagaccgacaataatccacctctcgcggtggatcccttttgacttgcaggttaattacttcaggttcagatccgttgattgctcgtgttcttgaaaatataatactcctgtttttacatccttgctatagttatcatgatcaccttgccgtacgttcgttggctttgattaatctggtgatttggttcaagatgatgtggtgtatacattttccatgcatttttctttggcttctttcggcatggactgacttgtgtttgtgttggttgttgcagtccgtaggataggatgagctgatgatgagcagctgcagctcgcaggattatttatttgtcgtggaagctggtgtgcaacgtctacgaattcgtgtaccagactacccttatatataagtactccgtatacatacaggtacgaaaaaaacgcgaatagtagagaaaaatttaatattaaataaatagaatagatgagtctttgaatccagatcaattagctaaccacttgtgaagctagccagaaaataaatccatgtacgtttctctactacaggtacgcgcacggtcggccacaccttgagctgcacgaatgttattcgcgttggacgaggcaggtgcgttacatgcttgtgtgtgcaagttgcggcctcatcgcgtttgtgtggctgtctcgttgtcgtccggatttttggatttttggtccgcacgcgcgcgccacgggtccgatcgatgatatcgtcatccctgccgtgctcgtacgggtcacgctcaagtgataccatgctcgccctggttcccaaacctccaatgccaccatgtgtttcaccagttgtgtgcctgcagcccacatggaaaatatatacggagtataaatctagggcctgctcactttgctattatttttaaccttattaagttttggcattatcaaattttggtaaggttatcaaaattttagcaaggttgtcaaattttgacaagattttatatgtacttactaaaatttggcaacaaactaaatgtagctacttttttaagtaactttgccaaaacttgataaggttgaaaatgatagcaaactgaacaagcctcgatttatgcttgcagaaagagtgagtgcacattttaggtcccatgaaatacatacacgtacatagctatcagcgtgtcctcgtaatacacattcaaatagcatcaataattcctttcccttactctataggaagcataattccttatatagagtataggttgatgcatatataaacgaatcatagcataccacatgacactaacttgataaaggttgtataatctttagactcaacatctactataaagacgcatatttatggacctcgtggatggactccaccatcatattaatattgtctctccaataggatcgataggtaaaaatgtcattagcattattgtcttctaatgtgaaacaaagtgagcgttctacaaaaatatttgacatcctcgtgttggagttcaaatttacaatctcaatgctttagcctatacaaaatcacctatgtagaattgtaatctcaccgacctgcttgagatgccattggtgttaattttctccttttgtttcttccttctcttcttcttcggtttcttttcttctcttcttttttcatcaccgagggcttcccgagatcacctcacgaatcctttctagtgcaagttttagggtttaggcaaagagtacgacatcccttctcctttgcctttcatctctttatataggcgctggtggggctcgagggttatctccaatttggttaggaattagttctactgttcacaaaactaactctccgtctttaggaatcagatacgtgtgatttatcttccttatctagctggcatttagctgataaaatcaaccaaaacctggtattgatagttatagtgagacaaacctctaatcctcaactattcaggatttacgttcacccgtggcacattagggttacatggtacaccaagaagcaacacatttagaatccataaactttttggcgtagaataatccgtgcatttttcatctttagttaacgtctgtttagttacgagtagaagagttaaaccagaccatgacatcgctcaaaagaaaaaaaacaagaaaagaaagaaagaccacgacagtttgacgagctagcagcgagagagagtttgttgggggccgtttgctgtggatcgttcaccagtcaccacacgaaacgatcgaagcagaggctgaggctgaggagagcagccgaaggaaggaagcccaaccgcgtggacggatagaaagaaggcgtgacccacaagccgccgctacttgcctccctcgtctcacgtatatccccttcccccgaatatccgccacgtggacggccctcgcctctctccgaccaccttaaccaatcaccacacagcagttaacccctctcctccccttcctcttctcccccctccctctcctcgtcgtctccaccaccaccatctccgtctccactcgatcgatcgatcgatctccataggtgggggaagggaagctttggaaggtggagggacggagggggggatgacgaggcggtgctcgcactgcagccacaacgggcacaactcgcggacgtgccccaaccgcggggtcaagatcttcggggtgcgcctcaccgatggctccatccgcaagagcgccagcatggggaacctctccctcctctcctccgccgccggatccaccagcggcggcgcctcccccgccgacggccccgacgccgcccccaccgccgccgacggctacgcctccgacgacttcgtccagggctcctcctccgccacccgcgaccgcaagaagggtcagcccccccccttcttcttctttcccaaccccttaatttcaatgatttaatcatcccaaaaaccattctggcctgatgcgacttactagatcctctccaacctcaggtttttcttcttcttgtgcttctttttttattattattcctactagtatgttcttcttcctttgctgcttcggcgtgtagatttgggagatttgatggagtactgctactagcagtcactgctagttgtttcttccaagtaggacagacgctagagaaagcatttaatgggcagattgtactgatggtcatggatgagtgatttggtactacttagctcatgcatacgccactccacttcaattaattactctcggtacaaggacggcgtatagatgcctccaactgtttgatgagatcacaaggacgttttgtcaaactcatgctcagctccatatttgtctaggataagtaagaatttagaatcagaccagatcgttccaacgagtaatgatggctgatcctgtggaactttttaatttgatcctttgcctctgcaaggatgcatggggccacgtgttctgagaggataacagtgtcgaattagggattttgtgagtggctggtaactaggctcagtgttctcatgtttagacacccgatcatcggagattggaacctatgattgcgtacggtgttgttagctctgttctgattcagaatgatttctagtttactgcgtagttatattcgcggtgttggtccaagaaaagtcttccaagctgtcagctttcaaaacccaagaaccttcctaatggcatgcctatgttaatgtgtgaaagcttcaaagcagcacgtgattgtttgatctttactgtggcagtagttcctactgtaacggccttactagaggtcatgccattggtagactgcgttgtcattgcctcattaacttgtacttccatccaaatttgatgcttggagtgcagttttagacttatatgcctactgacttaaatgtattggaaaagtcaaaagtatatgtttgtcctttatcaatttgtaatgaaaggcactaaattggataaaagaaatcgccttgaaatgtacaatttgctattcttttgacatttattctgttaagaggattatgccagattgacaatgttttaatcttgttaaccttctgcataacttgttaaggtggcaaaagacataaaatttgtctctttcccttttatgttctggcatttctcttggaatctcatagaatccttttactttttaagattggagtcctctctctgtgcgccctgtttcttaggaacgggctcttttttgggctggataattttcctttggtgataggcagtactgttattttgtgtagtagtcccaagtttgttggtatttttgtcagtatatgatgggagcttaactattacagttctccagcttcttgtactccagtcattactcgctacctgcgtgcctgcaggccacattctgtgtgccatgtttctgattaagatgactttgacaggtgttccttggactgaagaagaacaccggaggtttttgcttggattgcaaaagcttggcaaaggtgattggcgaggaatctctcgtaatttcgtggtctcaagaacacctactcaagtagccagtcatgctcagaaatattttatacgccaatccaatatgaccagaaggaaaagaaggtctagcctttttgacatggtgccagatgaggtagcttgcttgatcttatttcgattattgtgctgatattggcatgtagcataataagcctgcctgggtctattcttatattgagacgaggagattgctcatttgtgtggtgatagatatcatattgctaaaacttatctttttgaacaaattgtgtagtttatttatgtattgcatgaagacttgagaacacttttatccttgttcgaattagaaaggttgtactgttttctctgtactctaatgggggaactgaactgtgttttggtggttttacagtctatggaccttccaccacttcctggaggtcaagaaccagagacccaagtattaaatcaaccagcactacctccaccgagggaggaggaggaggtagattctatggagtcagatacttctgccgttgcagagagctcttccgcttctgctatcatgccagataatttgcagtcgacctatccagtgattgttccagcttatttctcgccctttttgcaattctcggttcctttctggcaaaatcagaaagatgaagatggtcctgtgcaagaaacacatgagattgtcaagcctgttccagttcattcaaagagcccaatcaacgttgatgagcttgttggcatgtcgaagctcagcataggagagtccaatcaagagacagtgtctacttctctttcattaaatctggtaggaggtcaaaatagacaatcagctttccatgcaaatccaccaacaagggcacaggcatgatctccttctgcacacaactgcatttagatgaatcccaggcaaaataagctttgcctccttgtttttttgtttttattttaagattaaccgttctccgtagtctgtatcatgtgctgtaagttatgctatgtatgaatgtatctgttgtttgtctggcacacatgataaatcactctatgttaacaaaatcagtaatggtagtgctgatcttcgtggttgtactgttgtaaactcttttataagaaaaaaaaatattagttagtc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071918.1 RefSeq:Os10g0561400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
| Line 73: |
Line 40: |
| | [[Category:Japonica Chromosome 10]] | | [[Category:Japonica Chromosome 10]] |
| | [[Category:Chromosome 10]] | | [[Category:Chromosome 10]] |
| | + | |
| | + | ==Structured Information== |
