Difference between revisions of "Os10g0561400"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Labs working on this gene)
 
(4 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os10g0561400''''' was reported as '''''MYBS3''''' in 2010 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice.
+
===Gene Symbol===
 +
*'''''Os10g0561400''''' '''<=>''' '''''MYBS3,OsMYBS3'''''
 
===Function===
 
===Function===
OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression. As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear. OsMYBS3 is most abundant in senescent leaves, in which sugars are depleted as a result of their transport to other tissues. OsMYBS3 may preventα-amylase genes from being induced by the low sugar level in senescent leaves, which would be a wasteful process in dying cells <ref name="refA" />. Yeast one-hybrid experiments demonstrated that OsMYBS1 and OsMYBS2 bind to the TATCCA element and transactivate a promoter containing the TATCCA element in vivo. Transient expression assays with barley half-seeds showed that OsMYBS1 and OsMYBS2 transactivate a promoter containing the TATCCA element when sugar is provided, whereas OsMYBS3 represses transcription of the same promoter under sugar starvation. Transient expression assays also showed that these three OsMYBSs cooperate with a GA-regulated transcription factor, HvMYBGa, in the transactivation of a low-pI barley α-amylase gene promoter in the absence of GA.
+
* OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice.
 +
* OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression.  
 +
* As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear.  
 +
 
 +
===Phenotypic analysis===
 +
* Transcription profiling of transgenic rice overexpressing or underexpressing MYBS3 led to the identification of many genes in the MYBS3-mediated cold signaling pathway.  
  
 
===Expression===
 
===Expression===
The open reading frames of OsMYBS1, OsMYBS2, and OsMYBS3 encode polypeptides of 306, 276, and 318 amino acid residues, respectively. The three OsMYBSs contain a highly conserved single DNA binding domain that is very similar to the DNA binding domains of other mammalian, Drosophila, and plant. OsMYBS3 is expressed in all tissues, with the highest level in senescent leaves. The levels of OsMYBS3 mRNAs are low in the presence of Suc but increase in the absence of Suc which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. OsMYBS3 is suppressed in the presence of Glc or GA but remains unchanged in the presence of abscisic acid. OsMYBS3 doesn't significantly enhance luciferase activity in the presence of Glc and repressed luciferase activity in the absence of Glc.  OsMYBS3 may serve as a repressor, for transcription of the promoter containing SRS <ref name="refA" />. OsMYBS3 in rice are enhanced by ABA and abiotic stresses <ref name="refC" /> and cold stress conditions <ref name="refD"/>, respectively.OsMYBS3 transgenic rice plants acquire cold tolerance with no penalty in terms of yield under normal field conditions. In addition, OsMYBS3 in rice regulates the expression of cold-related genes such as WRKY77 and Glu decarboxylase, both of which contain a TATCCA element in their promoters <ref name="refD" />.The barley half-seeds were cobombarded with the effector and reporter plasmids. The bombarded half-seeds were divided into two halves, each half was incubated with 0.3 M Glc or 0.3 M mannitol for 24 h, and luciferase activity was determined. Figure 9B shows that OsMYBS1 significantly enhanced luciferase activity in the presence of Glc to the same level as in the absence of Glc. Although OsMYBS2 and OsMYBS3 seemed to enhance luciferase expression slightly in the presence of Glc, they significantly suppressed luciferase activity in the absence of Glc. These results indicate that OsMYBS1 activates, whereas OsMYBS2 and OsMYBS3 repress, the transcription of a promoter containing only the TATCCA element and adjacent flanking sequences.
+
* Expression of MYBS3 was found to be ubiquitous in all tissues in seedlings and mature plants and in cultured suspension cells of rice
 
+
* Expression of MYBS3 Is Ubiquitous and Activated by Cold Stress
===Evolution===
 
OsMYBS3 is rich in both Pro (19 of 166 amino acids, or 11%) and acidic amino acids (22 of 166 amino acids, or 13%). Some 1R-Myb proteins, including CCA1, OsMYBS3, and PSR1, are 30 to 40% identical in the Myb domain with each other and possess a SHAQK(Y/F)F motif<ref name="refE" />. It is not clear why OsMYBS2 and OsMYBS3 do not form homodimers by themselves and why the three Os-MYBSs do not form heterodimers with each other <ref name="refA" />. Barley HvMYBS3, rice OsMYBS3 and maize ZmMYBSt1 are probably orthologous, because, in addition to the 100% identity of their DBD, they share 84.6% and 80.9% identical residues, respectively, along their whole protein sequences (WPS) <ref name="refB" />. Sequence comparison of single MYB-like domain TFs, MYB-like domain proteins and StMYB1R-1<ref name="refE" />. [[File:Plant Physiol.jpg|Figure 1. Sequence comparison of single MYB-like domain TFs and StMYB1R-1. A, Phylogenetic analysis of StMYB1R-1. The phylogenic tree was constructed with the DNASTAR program (DNASTAR, Inc.) using the deduced amino acid sequence of StMYB1R-1 and other single MYB-like domain protein sequences. B, Amino acid sequence alignment of StMYB1R-1 and other single MYB-like domain proteins. Accession numbers are as follows: StMYB1R-1, ABB86258; At1g19000, BAH19529; At1g74840, BAH56970; AtCCA1, AAB40525; AtLHY, NP_00103092; GmMYB176, ABH02865; GmMYB177, ABH02866; LeMYB1, CAB65169; MYBSt1, AAB32591; OsMYBS1, AAN63152; OsMYBS2, AAN63153; OsMYBS3, AAN63154; PTLe00585.1, AAX95766; and Sb01g029020, XP_002464930<ref name="refE" />.]] The 1R sequence of OsMYBS3 is most homologous with that of StMYB1 (92% identity) and is somewhat homologous with that of OsMYBS1 (87% identity) and OsMYBS2 (85% identity), and the 1R sequences of OsMYBS1 and OsMYBS2 are least homologous (77% identity) with each other. There is very low homology among the N- and C-terminal regions outside of the 1R regions of all of the MYBs with 1R DNA binding domains, except that OsMYBS3 and StMYB1 have 71% identity at the N-terminal 90–amino acid region and 62% identity at the C-terminal 70–amino acid region.[[File:1R.jpg|1R. />.]]
 
 
 
=== Knowledge Extension ===
 
To determine whether OsMYBS gene expression was regulated by sugars, total RNA was isolated from rice suspension cells cultured in the presence or absence of Suc for 48h and subjected to gel blot analysis using OsMYBS-specific DNAs as probes. Figure 2 shows that the levels of OsMYBS1 and OsMYBS3 mRNAs were low in the presence of Suc (lanes 1 to 8) but increased in the absence of Suc (lanes 9 to 16), which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. By contrast, the levels of OsMYBS2 were higher in the presence than in the absence of Suc. Transient expression assays with barley half-seeds were used as a system to study the function of OsMYBSs in sugar and hormone regulation in later experiments. To determine whether OsMYBSs are expressed in barley aleurone cells, total RNA was isolated from barley half-seeds and subjected to gel blot analysis using OsMYBS-specific DNAs as probes. Figure 3C shows that all of these OsMYBSs were expressed in barley aleurone cells in the absence of Glc. The expression levels of OsMYBS1 and OsMYBS3 were suppressed in the presence of Glc or GA but remained unchanged in the presence of abscisic acid. The expression of OsMYBS2 was enhanced in the presence of Glc and slightly suppressed by abscisic acid treatment. <ref name="refA" /> [[File:Plant Cell-2002-Lu-1963-80.jpg|Figure 2. Each of the Three OsMYBS Genes Is a Single-Copy Gene in the Rice Genome. Rice genomic DNA was digested with EcoRI (E), HindIII (H), and PstI (P) and subjected to gel blot analysis. OsMYBS1, OsMYBS2, or OsMYBS3 gene-specific DNA was used as a probe for hybridization of each of the three blots, which were prepared in parallel. Molecular mass markers (in kb) are shown at left<ref name="refA" />.]]
 
OsMYBSs Act Independently of or Cooperatively with Other Protein Factors for Promoter Transactivation
 
MYB, with one repeat, may bind to DNA as a dimer, as has been proposed (Jin and Martin, 1999), although this has not been proved experimentally. In the present study, we showed that OsMYBS1 is capable of forming a homodimer in vivo. It is not clear why OsMYBS2 and OsMYBS3 do not form homodimers by themselves and why the three Os-MYBSs do not form heterodimers with each other. The differential ability of OsMYBS in dimerization may lead to differential transactivation ability.
 
Both OsMYBS1 and OsMYBS2 transactivated the promoter containing an SRS in barley aleurone cells under repressed conditions; however, only OsMYBS1 transactivated the promoter containing the TATCCA element with adjacent flanking sequences (TATCCA+F) under repressed conditions. Furthermore, OsMYBS2 repressed the transcription of the promoter containing TATCCA+F even under derepressed conditions in a manner similar to OsMYBS3. These results suggest that additional sequences within SRS might be required for OsMYBS2 to function as a weak activator.
 
GARC contains the GARE sequence and three to four additional cis-acting promoter elements, including the TATCCA element, that are necessary for the GA activation of gene expression. In the present study, a consensus GARE sequence was not found in the 1.1-kb rice αAmy3 promoter or in SRS, and the αAmy3 promoter–Luc or SRS–CaMV35S minimal promoter–Luc chimeric gene did not respond to GA in barley aleurone cells.
 
The 331-bp barley Amy32b promoter contains a GARE sequence but does not contain a complete SRS-like sequence except for a putative G-box and the TATCCA element. The Amy32b promoter–Luc chimeric gene did not respond to sugar in barley aleurone cells. It appears that a complete sugar response complex or GARC sequence may determine whether an α-amylase gene promoter has the potential to respond to sugar or GA. OsMYBS1 and OsMYBS2 act as activators, whereas OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression; however, they all cooperate with HvMYBGa in high-level, GA-induced α-amylase gene expression. These studies suggest that OsMYBSs are multifunctional depending on the target promoter sequences and their interactions with other protein factors in response to different signals. The three OsMYBS genes are expressed in various tissues of the rice plant, indicating that they may play certain, not yet identified, physiological roles in these tissues.
 
 
 
 
== References ==
 
== References ==
 
<references>
 
<references>
<ref name="refA">Lu C A, Ho T D, Ho S L, et al. Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of α-amylase gene expression[J]. The Plant Cell Online, 2002, 14(8): 1963-1980.</ref>
+
* <ref name="ref1">
<ref name="refB">Rubio‐Somoza I, Martinez M, Abraham Z, et al. Ternary complex formation between HvMYBS3 and other factors involved in transcriptional control in barley seeds[J]. The Plant Journal, 2006, 47(2): 269-281.</ref>
+
Su CF, Wang YC, Hsieh TH, Lu CA, Tseng TH, Yu SM. A novel MYBS3-dependent
<ref name="refC">Liao Y, Zou HF, Wang HW, Zhang WK, Ma B, Zhang JS, Chen SY (2008) Soybean GmMYB76, GmMYB92, and GmMYB177 genes confer stress tolerance in transgenic Arabidopsis plants. Cell Res 18: 1047–1060.</ref>
+
pathway confers cold tolerance in rice. Plant Physiol. 2010 May;153(1):145-58.
<ref name="refD">Su C F, Wang Y C, Hsieh T H, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice[J]. Plant physiology, 2010, 153(1): 145-158.
+
doi: 10.1104/pp.110.153015. PubMed PMID: 20130099; PubMed Central PMCID:
 +
PMC2862423.
 +
 
 
</ref>
 
</ref>
<ref name="refE">Yoshioka S, Taniguchi F, Miura K, et al. The novel Myb transcription factor LCR1 regulates the CO2-responsive gene Cah1, encoding a periplasmic carbonic anhydrase in Chlamydomonas reinhardtii[J]. The Plant Cell Online, 2004, 16(6): 1466-1477.</ref>
 
 
</references>
 
</references>
 +
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
*Engineering Research Center for Plant Biotechnology and Germplasm Utilization, Ministry of Education, State Key Laboratory of Hybrid Rice, College of Life Sciences,Wuhan University, Wuhan,China
+
* Institute of Biotechnology, National Cheng Kung University, Tainan 701, Taiwan, Republic of China (C.-F.S.);
*Institute of Crop Sciences/National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing, China
+
* Institute of Molecular Biology (Y.-C.W., S.-M.Y.) and Institute of Plant and Microbial Biology (T.-H.H.), Academia Sinica, Nankang, Taipei 115, Taiwan, Republic of China; Department of Life Science,  
*Key Laboratory of Plant Resources, Institute of Botany, The Chinese Academy of Sciences, Beijing 100093, PR China
+
* National Central University, Zhongli, Taoyuan County 320, Taiwan, Republic of China (C.-A.L.);
*Bio-crop Development Division, National Academy of Agricultural Science, Rural Development Administration, Suwon 441–857, Republic of Korea
+
* Division of Biotechnology, Taiwan Agricultural Research Institute, Wu-Fong, Taichung County 413, Taiwan, Republic of China (T.-H.T.)
*Institute of Biotechnology, National Cheng Kung University, Tainan 701, Taiwan, Republic of China
 
*Department of Biology, Washington University, St. Louis, Missouri 63130
 
*Division of Integrated Life Science, Graduate School of Biostudies, Kyoto University, Oiwake-cho, Sakyo-ku, Kyoto, 606-8502, Japan
 
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os10g0561400|
 
Description = Similar to Transcription factor MYBS3|
 
Version = NM_001071918.1 GI:115483431 GeneID:4349385|
 
Length = 8307 bp|
 
Definition = Oryza sativa Japonica Group Os10g0561400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:22583739..22592045|
 
CDS = 22584003..22584473,22584753..22584961,22588740..22588764|
 
GCID = <gbrowseImage1>
 
name=NC_008403:22583739..22592045
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:22583739..22592045
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgttattcgcgttggacgaggcaggtgttccttggactgaagaagaacaccggaggtttttgcttggattgcaaaagcttggcaaaggtgattggcgaggaatctctcgtaatttcgtggtctcaagaacacctactcaagtagccagtcatgctcagaaatattttatacgccaatccaatatgaccagaaggaaaagaaggtctagcctttttgacatggtgccagatgagtctatggaccttccaccacttcctggaggtcaagaaccagagacccaagtattaaatcaaccagcactacctccaccgagggaggaggaggaggtagattctatggagtcagatacttctgccgttgcagagagctcttccgcttctgctatcatgccagataatttgcagtcgacctatccagtgattgttccagcttatttctcgccctttttgcaattctcggttcctttctggcaaaatcagaaagatgaagatggtcctgtgcaagaaacacatgagattgtcaagcctgttccagttcattcaaagagcccaatcaacgttgatgagcttgttggcatgtcgaagctcagcataggagagtccaatcaagagacagtgtctacttctctttcattaaatctggtaggaggtcaaaatagacaatcagctttccatgcaaatccaccaacaagggcacaggcatga</cdnaseq>|
 
AA = <aaseq>MLFALDEAGVPWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRT                    PTQVASHAQKYFIRQSNMTRRKRRSSLFDMVPDESMDLPPLPGGQEPETQVLNQPALP                    PPREEEEVDSMESDTSAVAESSSASAIMPDNLQSTYPVIVPAYFSPFLQFSVPFWQNQ                    KDEDGPVQETHEIVKPVPVHSKSPINVDELVGMSKLSIGESNQETVSTSLSLNLVGGQ                    NRQSAFHANPPTRAQA</aaseq>|
 
DNA = <dnaseqindica>7573..8043#7085..7293#3282..3306#agaggcgcgcgtcgccgtcgggcggcggcgaagccggagatggcggggacgccggggaggcgccctccggcagccggctccgcgccgcagcggaatccgaccggaggcaggtagataagtatcctgctcctcttccctcgcgttccagctcgcgaagtccccgtttaatttgattttgtatgcgtttttgctgggtagggttatggtatgtactagggtgtgttcgttcggggatggcgactagttcttcgagctttcgccggaggggaagatggcggtgcggccctcggggaaagaggggtaaggatttttcagtgcttgcctcttgggctcgtggtgaactggtgatagcttggagtgtgaggggatcgtcgacaaccgtggcgtgtgcttcgattattgcttaatttgttcaggttacgcgcgactctgtcagccagatgtagttggagagccttttgtcatatcctcatactgcctgtagttcgagacaaaaatcatattttcgaatattttacttttttgggatggttgctacgatgcagttgagtggttcagttgtgattggtgattgtctgtgtaggatgcatcaagcggtatttctgatttgggcctctggaagatggatttgagtgatgatgtgtaccaattgctttctgaaggtacttgtctgcttcgccatttctcaacaactgataaatttgtcaaatgtaaccgttcatttttacttggacgttcatcattcagttgatttgatgtcctttccaagctttgcttcttaaaaggacaaaagaatatttctatatttgtccggccaaattatctttagaacactttccatcttgaaaggcgtcaatgaaactgtactgtgcaaatctgccataggcatttttgatttggtattgtgcaaacaactacagcattctagaactgtatcacaagttcacaacccactttctatcactcttgctcattgcacattcatatcttgtttcagagaactgtttactccactgttgttgcttatatttcccttcaagtttgggacctgattctgaattctttcagaacaatggtgcacgttactgctgatcagcactattcggtcaataatgcagtgcagtcataagtgcaccatttcaagtgtatttgttagttggtactaaatatctgtgcattacagtgtttatatgatactaaaactcttcatgccagaacatttttagtttagtaagaaaccataaggtccaaaatggttggttcagtgttcagactagcagctcggcaaaatcttcttactaatgtttcagattaattatattgctgccatatactgggtgcgtatgattgagaaaattaaatctattaggtaacataaatatggttggttcagtgttcagactagcatctcagcaaaatcttcttactaatgtttcagattaattatattgctgccatatactgggtgcgtatgattgagaaaattaaatctattaggtaacataaatataaggcgtgtaggcttctgggctctggagtaccgttgttttgtgcaatgttcaactgagttgtttttaaactagagaatgagatataaacagaaaacaaatcatgaatcttcttattctttttaatgaactgactgtgtttctttatcattgttgatccagccgagcaacttttttaagtttatcttttatttccatacatcttatctctttgttttattgaaatggatttgtttatcaattcaataccagtgaagcatatgaatctgatgatggaaactgttgcaacggcacattcggaatatgccaatatggaatggctacccttgcctgcaggtatgctatctttttcacaacttttaattcatcaagttctgttctttctttagattatcactcacgtaaacaatatatatccacctgttgatatggtcctgtactccagtgtcagtttttttatatataaaaaaagatatggtccagtcactgctgatggatcctaacttatattttattcgataatttgaagatatatgctagtatcttgcaagggatattttgtccaactgcatcaacaaaattaggcatcaagatttggatgttggtaagcacatcctctctctagatcggtgcaagtgcaacctccgtcttgaatcttgatgacattagatgagaatatctccacacgaaaataatataggccattgctcactcagttgcttacatactctgttttactttagattatgatgcctttctacttcaaataggtaaatactctttagtacagaatataaaaaaaaggtaatatctctgtaacaagcaagtcactgtcaaaattatcctaacaccttcaagtttttgctatttttattaactgcgcccttgattgatccgtgactgtcatttttctttgacgcgttccgtgatagtcatggcttaggattaccgtgcataagggataaaggtgcatgctgatcgattgccgactttttgagtgtttagccacgctttttcttaacttatcctctttggtccgttcaaccccatggatgcaattttaattagttgcgagcagaaagcatattgttggcttagataagctgtcactgtttcgtgcttgtagcaatatgataatacagaatgcagtagtagaccgacaacattgtcccccggttttacgagtggtagaccgacaataatccacctctcgcggtggatcccttttgacttgcaggttaattacttcaggttcagatccgttgattgctcgtgttcttgaaaatataatactcctgtttttacatccttgctatagttatcatgatcaccttgccgtacgttcgttggctttgattaatctggtgatttggttcaagatgatgtggtgtatacattttccatgcatttttctttggcttctttcggcatggactgacttgtgtttgtgttggttgttgcagtccgtaggataggatgagctgatgatgagcagctgcagctcgcaggattatttatttgtcgtggaagctggtgtgcaacgtctacgaattcgtgtaccagactacccttatatataagtactccgtatacatacaggtacgaaaaaaacgcgaatagtagagaaaaatttaatattaaataaatagaatagatgagtctttgaatccagatcaattagctaaccacttgtgaagctagccagaaaataaatccatgtacgtttctctactacaggtacgcgcacggtcggccacaccttgagctgcacgaatgttattcgcgttggacgaggcaggtgcgttacatgcttgtgtgtgcaagttgcggcctcatcgcgtttgtgtggctgtctcgttgtcgtccggatttttggatttttggtccgcacgcgcgcgccacgggtccgatcgatgatatcgtcatccctgccgtgctcgtacgggtcacgctcaagtgataccatgctcgccctggttcccaaacctccaatgccaccatgtgtttcaccagttgtgtgcctgcagcccacatggaaaatatatacggagtataaatctagggcctgctcactttgctattatttttaaccttattaagttttggcattatcaaattttggtaaggttatcaaaattttagcaaggttgtcaaattttgacaagattttatatgtacttactaaaatttggcaacaaactaaatgtagctacttttttaagtaactttgccaaaacttgataaggttgaaaatgatagcaaactgaacaagcctcgatttatgcttgcagaaagagtgagtgcacattttaggtcccatgaaatacatacacgtacatagctatcagcgtgtcctcgtaatacacattcaaatagcatcaataattcctttcccttactctataggaagcataattccttatatagagtataggttgatgcatatataaacgaatcatagcataccacatgacactaacttgataaaggttgtataatctttagactcaacatctactataaagacgcatatttatggacctcgtggatggactccaccatcatattaatattgtctctccaataggatcgataggtaaaaatgtcattagcattattgtcttctaatgtgaaacaaagtgagcgttctacaaaaatatttgacatcctcgtgttggagttcaaatttacaatctcaatgctttagcctatacaaaatcacctatgtagaattgtaatctcaccgacctgcttgagatgccattggtgttaattttctccttttgtttcttccttctcttcttcttcggtttcttttcttctcttcttttttcatcaccgagggcttcccgagatcacctcacgaatcctttctagtgcaagttttagggtttaggcaaagagtacgacatcccttctcctttgcctttcatctctttatataggcgctggtggggctcgagggttatctccaatttggttaggaattagttctactgttcacaaaactaactctccgtctttaggaatcagatacgtgtgatttatcttccttatctagctggcatttagctgataaaatcaaccaaaacctggtattgatagttatagtgagacaaacctctaatcctcaactattcaggatttacgttcacccgtggcacattagggttacatggtacaccaagaagcaacacatttagaatccataaactttttggcgtagaataatccgtgcatttttcatctttagttaacgtctgtttagttacgagtagaagagttaaaccagaccatgacatcgctcaaaagaaaaaaaacaagaaaagaaagaaagaccacgacagtttgacgagctagcagcgagagagagtttgttgggggccgtttgctgtggatcgttcaccagtcaccacacgaaacgatcgaagcagaggctgaggctgaggagagcagccgaaggaaggaagcccaaccgcgtggacggatagaaagaaggcgtgacccacaagccgccgctacttgcctccctcgtctcacgtatatccccttcccccgaatatccgccacgtggacggccctcgcctctctccgaccaccttaaccaatcaccacacagcagttaacccctctcctccccttcctcttctcccccctccctctcctcgtcgtctccaccaccaccatctccgtctccactcgatcgatcgatcgatctccataggtgggggaagggaagctttggaaggtggagggacggagggggggatgacgaggcggtgctcgcactgcagccacaacgggcacaactcgcggacgtgccccaaccgcggggtcaagatcttcggggtgcgcctcaccgatggctccatccgcaagagcgccagcatggggaacctctccctcctctcctccgccgccggatccaccagcggcggcgcctcccccgccgacggccccgacgccgcccccaccgccgccgacggctacgcctccgacgacttcgtccagggctcctcctccgccacccgcgaccgcaagaagggtcagcccccccccttcttcttctttcccaaccccttaatttcaatgatttaatcatcccaaaaaccattctggcctgatgcgacttactagatcctctccaacctcaggtttttcttcttcttgtgcttctttttttattattattcctactagtatgttcttcttcctttgctgcttcggcgtgtagatttgggagatttgatggagtactgctactagcagtcactgctagttgtttcttccaagtaggacagacgctagagaaagcatttaatgggcagattgtactgatggtcatggatgagtgatttggtactacttagctcatgcatacgccactccacttcaattaattactctcggtacaaggacggcgtatagatgcctccaactgtttgatgagatcacaaggacgttttgtcaaactcatgctcagctccatatttgtctaggataagtaagaatttagaatcagaccagatcgttccaacgagtaatgatggctgatcctgtggaactttttaatttgatcctttgcctctgcaaggatgcatggggccacgtgttctgagaggataacagtgtcgaattagggattttgtgagtggctggtaactaggctcagtgttctcatgtttagacacccgatcatcggagattggaacctatgattgcgtacggtgttgttagctctgttctgattcagaatgatttctagtttactgcgtagttatattcgcggtgttggtccaagaaaagtcttccaagctgtcagctttcaaaacccaagaaccttcctaatggcatgcctatgttaatgtgtgaaagcttcaaagcagcacgtgattgtttgatctttactgtggcagtagttcctactgtaacggccttactagaggtcatgccattggtagactgcgttgtcattgcctcattaacttgtacttccatccaaatttgatgcttggagtgcagttttagacttatatgcctactgacttaaatgtattggaaaagtcaaaagtatatgtttgtcctttatcaatttgtaatgaaaggcactaaattggataaaagaaatcgccttgaaatgtacaatttgctattcttttgacatttattctgttaagaggattatgccagattgacaatgttttaatcttgttaaccttctgcataacttgttaaggtggcaaaagacataaaatttgtctctttcccttttatgttctggcatttctcttggaatctcatagaatccttttactttttaagattggagtcctctctctgtgcgccctgtttcttaggaacgggctcttttttgggctggataattttcctttggtgataggcagtactgttattttgtgtagtagtcccaagtttgttggtatttttgtcagtatatgatgggagcttaactattacagttctccagcttcttgtactccagtcattactcgctacctgcgtgcctgcaggccacattctgtgtgccatgtttctgattaagatgactttgacaggtgttccttggactgaagaagaacaccggaggtttttgcttggattgcaaaagcttggcaaaggtgattggcgaggaatctctcgtaatttcgtggtctcaagaacacctactcaagtagccagtcatgctcagaaatattttatacgccaatccaatatgaccagaaggaaaagaaggtctagcctttttgacatggtgccagatgaggtagcttgcttgatcttatttcgattattgtgctgatattggcatgtagcataataagcctgcctgggtctattcttatattgagacgaggagattgctcatttgtgtggtgatagatatcatattgctaaaacttatctttttgaacaaattgtgtagtttatttatgtattgcatgaagacttgagaacacttttatccttgttcgaattagaaaggttgtactgttttctctgtactctaatgggggaactgaactgtgttttggtggttttacagtctatggaccttccaccacttcctggaggtcaagaaccagagacccaagtattaaatcaaccagcactacctccaccgagggaggaggaggaggtagattctatggagtcagatacttctgccgttgcagagagctcttccgcttctgctatcatgccagataatttgcagtcgacctatccagtgattgttccagcttatttctcgccctttttgcaattctcggttcctttctggcaaaatcagaaagatgaagatggtcctgtgcaagaaacacatgagattgtcaagcctgttccagttcattcaaagagcccaatcaacgttgatgagcttgttggcatgtcgaagctcagcataggagagtccaatcaagagacagtgtctacttctctttcattaaatctggtaggaggtcaaaatagacaatcagctttccatgcaaatccaccaacaagggcacaggcatgatctccttctgcacacaactgcatttagatgaatcccaggcaaaataagctttgcctccttgtttttttgtttttattttaagattaaccgttctccgtagtctgtatcatgtgctgtaagttatgctatgtatgaatgtatctgttgtttgtctggcacacatgataaatcactctatgttaacaaaatcagtaatggtagtgctgatcttcgtggttgtactgttgtaaactcttttataagaaaaaaaaatattagttagtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071918.1 RefSeq:Os10g0561400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 78: Line 40:
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Chromosome 10]]
 
[[Category:Chromosome 10]]
 +
 +
==Structured Information==

Latest revision as of 01:23, 17 February 2017

The rice Os10g0561400 was reported as MYBS3 in 2010 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os10g0561400 <=> MYBS3,OsMYBS3

Function

  • OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice.
  • OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression.
  • As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear.

Phenotypic analysis

  • Transcription profiling of transgenic rice overexpressing or underexpressing MYBS3 led to the identification of many genes in the MYBS3-mediated cold signaling pathway.

Expression

  • Expression of MYBS3 was found to be ubiquitous in all tissues in seedlings and mature plants and in cultured suspension cells of rice
  • Expression of MYBS3 Is Ubiquitous and Activated by Cold Stress

References

  1. Su CF, Wang YC, Hsieh TH, Lu CA, Tseng TH, Yu SM. A novel MYBS3-dependent pathway confers cold tolerance in rice. Plant Physiol. 2010 May;153(1):145-58. doi: 10.1104/pp.110.153015. PubMed PMID: 20130099; PubMed Central PMCID: PMC2862423.

You can also add sub-section(s) at will.

Labs working on this gene

  • Institute of Biotechnology, National Cheng Kung University, Tainan 701, Taiwan, Republic of China (C.-F.S.);
  • Institute of Molecular Biology (Y.-C.W., S.-M.Y.) and Institute of Plant and Microbial Biology (T.-H.H.), Academia Sinica, Nankang, Taipei 115, Taiwan, Republic of China; Department of Life Science,
  • National Central University, Zhongli, Taoyuan County 320, Taiwan, Republic of China (C.-A.L.);
  • Division of Biotechnology, Taiwan Agricultural Research Institute, Wu-Fong, Taichung County 413, Taiwan, Republic of China (T.-H.T.)

Structured Information