Difference between revisions of "Os03g0406100"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os03g0406100| Description = SPX, N-terminal domain containing protein| Version = NM_001056867.1 GI:115453462 GeneID:4333078| Length = 833 bp| D...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os03g0406100''''' was reported as '''''OsSPX5''''' in 2009 <ref name="ref1" /> by researchers from China.  
GeneName = Os03g0406100|
 
Description = SPX, N-terminal domain containing protein|
 
Version = NM_001056867.1 GI:115453462 GeneID:4333078|
 
Length = 833 bp|
 
Definition = Oryza sativa Japonica Group Os03g0406100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os03g0406100''''' '''<=>''' '''''OsSPX5,SPX5'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
* The rice (Oryza sativa L.) genome contains at least six genes exclusively with an SPX (SYG1/PHO81/XPR1) domain at the N-terminal, designated as '''''OsSPX1-6'''''.
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
+
* Among them, five genes, '''''OsSPX1, OsSPX2, OsSPX3, OsSPX5 and OsSPX6''''' are responsive to Pi-starvation in shoots and/or in roots.
AP = Chromosome 3:17281276..17282108|
+
* '''''OsSPX1''''' regulates '''''OsSPX2, OsSPX3 and OsSPX5''''' at the transcription level.
CDS = 17281276..17281494,17281584..17282108|
+
* '''''OsSPX3''''' downregulates '''''OsIPS1''''' and suppresses the responses of '''''OsmiR399''''' and '''''OsPHO2''''' to Pi-starvation.
GCID = <gbrowseImage1>
+
* Whether '''''OsSPX4''''' functions as ScPHO81 in Pi-signaling pathway on plant Pi-starvation tolerance is an interesting question.
name=NC_008396:17281276..17282108
+
* Overexpression of '''''OsSPX3''''' inhibits plant growth
source=RiceChromosome03
+
 
preset=GeneLocation
+
===Expression===
</gbrowseImage1>|
+
* Except for OsSPX5, the expression was detected only in roots and callus, a constitutive expression pattern was observed in five other genes.
GSID = <gbrowseImage2>
+
* The transcript level of OsSPX1-3 was higher in root, leaf and callus than in stem, panicle and seed.  
name=NC_008396:17281276..17282108
+
* The transcript level of OsSPX6 in root and leaf was much higher than in other tissues. RT-PCR analysis indicates that except for OsSPX4, other SPX genes were induced by Pi-starvation in shoot and/or in root
source=RiceChromosome03
+
 
preset=GeneLocation
+
===Subcellular Localization===
</gbrowseImage2>|
+
* '''''OsSPX1''''' and '''''OsSPX2 '''''were localized exclusively to the nucleus, and OsSPX4 to membrane (Figure 4H,I,K), while fluorescence of OsSPX3-GFP was present in onion cells as many fluorescent speckles in the cytoplasm (Figure 4J).
CDNA = <cdnaseq>atgaagttcgggaagcggctgaagaggcagatcgaggagagcctgccggagtggcgcgaccatttcctcaactacaaggagctcaagcgccgcctcaacgccgtctcctcccccgaccccgccgccgaggcccgcttcctcgccctcctccacgccgaggtcgacaagttcaacgccttcttcctcgagcaggaggaggacttcgtcatcaggcagcgggagctgcaggagaggatccagtcgtcgtcgtcggcggcggcggagatggaggggcgggtgcggagggaggtggtggacctgcacggggagatggtgctgctgctcaactacagcagcatcaactacacggggctcgccaagatcctcaagaagtacgacaagcgcaccggcggcgtgctccgcctccccgtcatcgccggcgtcctccgccagcccttctacgccaccgacctcctctccagcctcgtcagggactgcgaggccatcatggacgccgtcttcccctccctcccctccccctccgccgccgccgccgccgccgcccgcgccgccgccgagcaggccatcttccgcaacaccgtcgccgccctgctcaccatgcaggaggtccgcagcggcagctccacctacggccacttctccctcccgccgatgaccccgctgcccgactccgactggctcatccagtccgtccagccgccgccgccgccgccgccgtcgtcgccgctcatcatccccacgtag</cdnaseq>|
+
 
AA = <aaseq>MKFGKRLKRQIEESLPEWRDHFLNYKELKRRLNAVSSPDPAAEA                    RFLALLHAEVDKFNAFFLEQEEDFVIRQRELQERIQSSSSAAAEMEGRVRREVVDLHG                    EMVLLLNYSSINYTGLAKILKKYDKRTGGVLRLPVIAGVLRQPFYATDLLSSLVRDCE                    AIMDAVFPSLPSPSAAAAAAARAAAEQAIFRNTVAALLTMQEVRSGSSTYGHFSLPPM                    TPLPDSDWLIQSVQPPPPPPPSSPLIIPT</aaseq>|
+
[[File:238-Os10g0392600.png|center|thumb|727px|'''Snapshot Figure 4.''' ''Histochemical analysis and subcellular localization of the OsSPX proteins.<ref name="ref1" />.'']]
DNA = <dnaseqindica>1..219#309..833#atgaagttcgggaagcggctgaagaggcagatcgaggagagcctgccggagtggcgcgaccatttcctcaactacaaggagctcaagcgccgcctcaacgccgtctcctcccccgaccccgccgccgaggcccgcttcctcgccctcctccacgccgaggtcgacaagttcaacgccttcttcctcgagcaggaggaggacttcgtcatcaggcagcgggtacacaataaatacttcaattaatttgctcctccctcctcgcgtcgatcggtcggccatggaaatgagtgatatgtgtatgggtgcaggagctgcaggagaggatccagtcgtcgtcgtcggcggcggcggagatggaggggcgggtgcggagggaggtggtggacctgcacggggagatggtgctgctgctcaactacagcagcatcaactacacggggctcgccaagatcctcaagaagtacgacaagcgcaccggcggcgtgctccgcctccccgtcatcgccggcgtcctccgccagcccttctacgccaccgacctcctctccagcctcgtcagggactgcgaggccatcatggacgccgtcttcccctccctcccctccccctccgccgccgccgccgccgccgcccgcgccgccgccgagcaggccatcttccgcaacaccgtcgccgccctgctcaccatgcaggaggtccgcagcggcagctccacctacggccacttctccctcccgccgatgaccccgctgcccgactccgactggctcatccagtccgtccagccgccgccgccgccgccgccgtcgtcgccgctcatcatccccacgtag</dnaseqindica>|
+
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056867.1 RefSeq:Os03g0406100]|
+
You can also add sub-section(s) at will.
}}
+
 
[[Category:Genes]]
+
==Labs working on this gene==
[[Category:Japonica mRNA]]
+
* State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, China
[[Category:Oryza Sativa Japonica Group]]
+
==References==
[[Category:Japonica Genes]]
+
<references>
[[Category:Japonica Chromosome 3]]
+
* <ref name="ref1">
[[Category:Chromosome 3]]
+
Wang Z, Hu H, Huang H, Duan K, Wu Z, Wu P. Regulation of OsSPX1 and OsSPX3 on
 +
expression of OsSPX domain genes and Pi-starvation signaling in rice. J Integr
 +
Plant Biol. 2009 Jul;51(7):663-74. doi: 10.1111/j.1744-7909.2009.00834.x. PubMed
 +
PMID: 19566645.
 +
</ref>
 +
</references>
 +
 
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]

Latest revision as of 02:14, 17 February 2017

The rice Os03g0406100 was reported as OsSPX5 in 2009 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os03g0406100 <=> OsSPX5,SPX5

Function

  • The rice (Oryza sativa L.) genome contains at least six genes exclusively with an SPX (SYG1/PHO81/XPR1) domain at the N-terminal, designated as OsSPX1-6.
  • Among them, five genes, OsSPX1, OsSPX2, OsSPX3, OsSPX5 and OsSPX6 are responsive to Pi-starvation in shoots and/or in roots.
  • OsSPX1 regulates OsSPX2, OsSPX3 and OsSPX5 at the transcription level.
  • OsSPX3 downregulates OsIPS1 and suppresses the responses of OsmiR399 and OsPHO2 to Pi-starvation.
  • Whether OsSPX4 functions as ScPHO81 in Pi-signaling pathway on plant Pi-starvation tolerance is an interesting question.
  • Overexpression of OsSPX3 inhibits plant growth

Expression

  • Except for OsSPX5, the expression was detected only in roots and callus, a constitutive expression pattern was observed in five other genes.
  • The transcript level of OsSPX1-3 was higher in root, leaf and callus than in stem, panicle and seed.
  • The transcript level of OsSPX6 in root and leaf was much higher than in other tissues. RT-PCR analysis indicates that except for OsSPX4, other SPX genes were induced by Pi-starvation in shoot and/or in root

Subcellular Localization

  • OsSPX1 and OsSPX2 were localized exclusively to the nucleus, and OsSPX4 to membrane (Figure 4H,I,K), while fluorescence of OsSPX3-GFP was present in onion cells as many fluorescent speckles in the cytoplasm (Figure 4J).
Snapshot Figure 4. Histochemical analysis and subcellular localization of the OsSPX proteins.[1].

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, China

References

  1. 1.0 1.1 Wang Z, Hu H, Huang H, Duan K, Wu Z, Wu P. Regulation of OsSPX1 and OsSPX3 on expression of OsSPX domain genes and Pi-starvation signaling in rice. J Integr Plant Biol. 2009 Jul;51(7):663-74. doi: 10.1111/j.1744-7909.2009.00834.x. PubMed PMID: 19566645.


Structured Information