|
|
| (5 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os01g0165000''''' was reported as '''''OsDREB2A''''' in 2011 <ref name="ref1" /> by researchers from India. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0165000''''' '''''<=>''''' '''''OsDREB2A, OsDREB2a, ERF40, OsERF#040, OsERF040, OsERF40''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| | + | * Stress responsive transcriptional regulation is an adaptive strategy of plants that alleviates the adverse effects of environmental stresses. |
| | + | * The ectopic overexpression of Dehydration-Responsive Element Binding transcription factors (DREBs) either in homologous or in heterologous plants improved stress tolerance indicating the DRE/DREB regulon is conserved across plants. |
| | + | * '''''OsDREB2A''''' confers stress tolerance in homologous rice system that failed in the heterologous Arabidopsis system earlier. |
| | | | |
| − | Our results show that the LcSAIN1 gene might play an important positive modulation role in increasing the expression of transcription factors (MYB2 and DREB2A) and functional genes (P5CS and RAB18) in transgenic plants under salt stress and that it augments stress tolerance through the accumulation of compatible solutes (proline and soluble sugar) and the alleviation of changes in reactive oxygen species<ref name="pmid:23695503"/>.
| + | ===Phenotypic analysis=== |
| − | | + | * 30 transgenic T0 rice plants overexpressing '''''OsDREB2A''''' were generated by researchers which were devoid of any growth penalty or phenotypic abnormalities during stressed or non-stressed conditions. |
| − | The dehydration responsive element binding (DREB) transcription factors play an important role in regulating stress-related genes<ref name="pmid:24376625"/>.
| + | * Integration of T-DNA in the rice genome and stress inducible overexpression of OsDREB2A had occurred in these transgenic lines. Functional analyses of T 1-3 and T 1-10 lines revealed significant tolerance to osmotic, salt and dehydration stresses during simu- lated stress conditions with enhanced growth performance as compared to wild type. |
| − | | |
| − | The DREB and CBF transcription factors play a critical role in plant development and abiotic stress responses and, therefore, represent attractive targets for a molecular plant breeding approach<ref name="pmid:22078375"/>.
| |
| − | | |
| − | MYB-type transcription factors play a diverse role in plant development and response to abiotic stress<ref name="pmid:22301384"/>.
| |
| − | | |
| − | OsDREB2A, a member of the DREBP subfamily of AP2/ERF transcription factors in rice (Oryza sativa), is involved in the abiotic stress response<ref name="pmid:24376625"/>.
| |
| − | | |
| − | Induced over-expression of the transcription factor OsDREB2A improves drought tolerance in rice<ref name="pmid:22078375"/>.
| |
| − | | |
| − | These findings suggest that OsMYB2 encodes a stress-responsive MYB transcription factor that plays a regulatory role in tolerance of rice to salt, cold, and dehydration stress<ref name="pmid:22301384"/>.
| |
| − | | |
| − | ZFP179 encodes a 17.95 kDa protein with two C2H2-type zinc finger motifs having transcriptional activation activity<ref name="pmid:20460361"/>.
| |
| − | | |
| − | Overexpressing OsDREB2A in soybeans enhanced salt tolerance by accumulating osmolytes, such as soluble sugars and free proline, and improving the expression levels of some stress-responsive transcription factors and key genes<ref name="pmid:24376625"/>.
| |
| − | | |
| − | DREB2s (dehydration-responsive element-binding protein 2s) are transcription factors that interact with a cis-acting DRE (dehydration-responsive element)/CRT (C-repeat) sequence and activate the expression of downstream genes involved in water- and heat-shock stress responses and tolerance in Arabidopsis thaliana<ref name="pmid:20049613"/>.
| |
| − | | |
| − | ===Expression===
| |
| − | Please input expression information here.
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Plant Molecular Biology Laboratory, International Centre for Genetic Engineering and Biotechnology (ICGEB), Aruna Asaf Ali Marg, New Delhi 110 067, India |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Mallikarjuna G, Mallikarjuna K, Reddy MK, Kaul T. Expression of OsDREB2A |
| | + | transcription factor confers enhanced dehydration and salt stress tolerance in |
| | + | rice (Oryza sativa L.). Biotechnol Lett. 2011 Aug;33(8):1689-97. doi: |
| | + | 10.1007/s10529-011-0620-x. PubMed PMID: 21528404. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0165000|
| |
| − | Description = DRE binding protein 2|
| |
| − | Version = NM_001048642.1 GI:115434697 GeneID:4324418|
| |
| − | Length = 4744 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0165000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:3355461..3360204|
| |
| − | CDS = 3355782..3355828,3356445..3357222|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:3355461..3360204
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:3355461..3360204
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggagcggggggaggggaggaggggagattgctccgtgcaagtgaggaagaagagaacgcgaaggaaaagcgatggccctgattcaatcgctgaaaccatcaagtggtggaaggagcaaaaccagaagctccaggaggagaatagctccaggaaagcgccagccaaggggtccaagaaagggtgcatggctgggaaaggaggtccggaaaattcaaattgtgcttaccgcggtgtcaggcaacggacatggggtaagtgggtggctgagatccgtgaaccaaaccgtggaaggcgcctatggctaggatcatttcctactgcgctggaggctgcgcatgcatacgatgaggcggcaagggcaatgtatggtcccacagcacgtgtcaattttgcagataattccacagatgccaactctggctgcacatcagcaccttcattgatgatgtctaatgggccggccactataccttctgatgagaaggatgagctggaatctcctcctttcatcgtggctaatgggccagctgtgttgtatcagcctgataagaaggatgtgttggaacgtgtagtccctgaggtgcaggatgttaaaacagaagggagcaatggcttgaaacgtgtttgtcaggagcggaagaatatggaggtatgtgaatcagaagggatcgttttacacaaagaagtgaacataagttatgattatttcaatgtccatgaagttgttgagatgataattgttgaattaagtgctgatcagaaaacggaagtacatgaagagtaccaagagggagatgatgggtttagccttttctcctattag</cdnaseq>|
| |
| − | AA = <aaseq>MERGEGRRGDCSVQVRKKRTRRKSDGPDSIAETIKWWKEQNQKL QEENSSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWL GSFPTALEAAHAYDEAARAMYGPTARVNFADNSTDANSGCTSAPSLMMSNGPATIPSD EKDELESPPFIVANGPAVLYQPDKKDVLERVVPEVQDVKTEGSNGLKRVCQERKNMEV CESEGIVLHKEVNISYDYFNVHEVVEMIIVELSADQKTEVHEEYQEGDDGFSLFSY</aaseq>|
| |
| − | DNA = <dnaseqindica>322..368#985..1762#agcagccgcccccgcccgcggttgcttcccctccccaccacgtcaaaacccaaccccaaccatgatgctcctgcgccaccaccaccacccccacagcggcgccgccaccaccagcagcagctgcagcggcggcggcggctgttagagaggagggcacacaccaccaccgacaccgacacgctcgccatgccaccaagcgaggcggcggcgtgaggcgacgcagatctgaacggaggaggaataggaagaagggaggaggaggggagggagaggagttggaagagttggaggaggaggagatctctttcttgttcccgctcgatggagcggggggaggggaggaggggagattgctccgtgcaagtgaggtgagctgggattttcttgacttgttttttttattctttttttctctcgtgatgaatctctgagcattgctgagagcggcgctgcttgtggttgttgtggagtagttgcggcatggaatcgatgcatgcttgtgtgcttactttttatcggtagtaattcttgttatgaacatgttgaaagtagagtaaggctatctgtttgtccgtctaattcgtttgaagaatgtttttgtttccctttcgtcaagtttattattagttgggaattatagctggatgagatttcaggacggcgtctagtagctttcatgtgttaaatcgggtggaatagtgacacccttgaaattgaaattgagtgggaaatcttctgtgttcttggcggtgcacgtgctgttgcttgtggaatgccatcgtggcgcaacatgaaaaagaaaagaagtattttattcttagggccgcttaccgttgattgctgatagcctccttgatttttggacaaatgaaaaggattccgcttttggtttgttgtttttcataatttcaattgcatgctgtttcgatttgtgtcttgcaatgttcagctttgtggaattattgagttacctcattgggtcaggaagaagagaacgcgaaggaaaagcgatggccctgattcaatcgctgaaaccatcaagtggtggaaggagcaaaaccagaagctccaggaggagaatagctccaggaaagcgccagccaaggggtccaagaaagggtgcatggctgggaaaggaggtccggaaaattcaaattgtgcttaccgcggtgtcaggcaacggacatggggtaagtgggtggctgagatccgtgaaccaaaccgtggaaggcgcctatggctaggatcatttcctactgcgctggaggctgcgcatgcatacgatgaggcggcaagggcaatgtatggtcccacagcacgtgtcaattttgcagataattccacagatgccaactctggctgcacatcagcaccttcattgatgatgtctaatgggccggccactataccttctgatgagaaggatgagctggaatctcctcctttcatcgtggctaatgggccagctgtgttgtatcagcctgataagaaggatgtgttggaacgtgtagtccctgaggtgcaggatgttaaaacagaagggagcaatggcttgaaacgtgtttgtcaggagcggaagaatatggaggtatgtgaatcagaagggatcgttttacacaaagaagtgaacataagttatgattatttcaatgtccatgaagttgttgagatgataattgttgaattaagtgctgatcagaaaacggaagtacatgaagagtaccaagagggagatgatgggtttagccttttctcctattagagtagtagtcatgctgcgggtcaataggaatatttcattctagctgctaggggatacttcaaatatctgcaacctgaagctttgtagtcatttacggttttcgtcttactgggtaatagctttatatatactataagccaactggtacaagaagttgtactgtgtgttgagtgcactgtggtaaaaatgaatctatatttaatgagcttactctgtcaatatttttgcttattttagtgtggttaaactcaggttagatattcaaaacgagtggcagatacttcaaagactttaggatcgaattaaattctcaaacaggtatattaggaagtttatttctgcatgcataaaagtatgacaaactatgatagtacaaatttgcatgcatatggaattttaaatacttaaacatactactatcgcattatagcgctctatggtcattcaaagtaccaaaagatacatcatggagatttcataaggggaagttgcagacattctctgaattcaagcctccttgtttcactgtgaaaggtcttctgtttgttaggccagtaggtcagccaaatccagcctctaatctcccagtccatggtcttccctaatgctgcaccacagatcttccaccagacgctgtctccatattcatcacgtgcgaaaatgacaccacccttcttcgtgaatgggcgatacacggtcgagtacctgtcacgaaaccaggcccgtggctgaagcagggagagcttggaaggctttgaagaataaacctcccttccgtttacaccatcatggagaaaccagttcaaggttgtagtgtttccatgcacagactgttcaaatttccagggtttcatggtcagtgtgaggctttcgctgaccgatgcctttagtccaaatgtgtttggggggtcgaatgaaccttcaatgcccttctcaaggccaaactcatgcgtggggttgtcggaggacttgctgactgaaaccgacaggacatctgattgttgcataggtgtgatttgcagcataacacgtgatggaaagtgcttctcctcagagccatgtccacgttcagtcatgaggatctcggagaccaaagagtccacatcacacctgagatgaatccactgtaagtgccgctcttggttttagatgatacacgtatggttgttttttttccttgtgcagttaattgtaactttgaaacaattcagtttgtagatagactgcttttcaaggtctagaaaactctgatttaactacctaaattgagttcttctgcagctggtatacagggagaagcatgttaccgaactatgcataattgcttgctcaatgttaccttactgtaggcaccaaccaaattatttgctagttaaacctttagctttttttaccaaacatatgcagctacgctttgcatgccgcaaacttaattggttcccccgagtgatactactgtcacctcaggatgagtaggttttttattttcacctaaattagtaagtgtgtatacagttcatatgagatagaatcaaatccttgaataaattactgaccttatgttgtccacctttatctcgacatcaatccagttgtcccttctgattgttttgtaggcgagctgaatcacaccttcaagttgctgataagtaagcgagaagagaaggcgctcatcctgtgttggcactgcaggatcttccatgctcatggcaatgagtgggcagtatagctggaccttccagagcccacttgctgaaagagcatatgagaacagtggcgatggcaccccaaatgaatggtgtgaggatcgttgctcaacaatccagttagtcactgcaagattcattgtctgcatccattgctcctcaaggtttgctcccaacattctgacaaaggtctttgcagcatctttgcactttggcccagtcagctgagtcctcagggattcgaggcatcgacagcgaagagcatggggagcctcatagatgcaaactaggaaggccagggacaagaaaactatgttaaacacgtcctttagattgccatgaatctgtgccctgggaaactgaaaggacagctttttgtttggtccggatctcagcacccagtccacaatgtcaacaaacaactctaacatctcttgttcgtctagagactgctgggtgtatgatttcaggtggactggttttgacgtccacagagaaattggcacacggtaatttgcaaagatggagaaggtgacaaaggagggctgggtgggaggggttttgacaactgataggttcaccgatggctgtgatgattctgatgctgatggtgtggggcagatgcaaagggacatggcgttggagcgccattgggagaacggaggcaggttggtgatccaaccccatacatcaagaggtaagctgtgagccattacgttgttgaaaacttgagcttgttttgcaatgtgggagtatcccagtattggtgtggttttatagatggaagagatgatggttcctcagataaaattttggctcatccatgactgagtctaatgaagcacggcataatttttggtaaagcggattcttggttgttagaagaggaaatcaagtcattgagctgaggaatctttgttgttaattggagtttgaagaatcttcatttgtgctttgcacaggtgctaaagccaaaagttaactgctatacggtaatatgatatatcaaacccaagttggttggctaatgttgtagtgaagagaatataacgtggctctaaacaggaaagctggaaagaacgatatggttgggtggaatggattagtttggatggattctggataactcggttcaataagggcctaacgacaccaaatttgtgacttgaaggttagcttgtgtgtcgactgggaattggaacctgatgcatctcactctttgcttccgttccgtcaagcttcaagatttacctctcaatcgagtattgctttatac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048642.1 RefSeq:Os01g0165000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |