|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os01g0813100''''' was reported as '''''OsbZIP09''''' in 2008 <ref name="ref1" /> by researchers from India. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0813100''''' '''<=>''' '''''OsbZIP09,OsbZIP, bZIP09''''' |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes. |
| | + | * The '''''OsbZIP''''' proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and |
| | + | |
| | + | the Leu zipper dimerization region. |
| | + | * bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction |
| | + | |
| | + | and development, and photomorphogenesis, and are also involved in stress and hormone signaling. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to |
| | + | |
| | + | various stages of panicle and seed development. |
| | + | * bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic |
| | + | |
| | + | stress and light irradiation. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | * The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous |
| | | | |
| − | You can also add sub-section(s) at will. | + | bZIP domains exist in plants. |
| | + | * Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains. |
| | + | * Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding |
| | + | |
| | + | site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively. |
| | + | <br> |
| | + | '''''You can also add sub-section(s) at will.''''' |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi |
| | + | |
| | + | 110021, India |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression |
| | + | analysis of the basic leucine zipper transcription factor family in rice. Plant |
| | + | Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID: |
| | + | PMC2245831. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0813100|
| |
| − | Description = Eukaryotic transcription factor, DNA-binding domain containing protein|
| |
| − | Version = NM_001051133.2 GI:297597836 GeneID:4327590|
| |
| − | Length = 2580 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0813100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:36321573..36324152|
| |
| − | CDS = 36321573..36321653,36322886..36322900,36323039..36323110,36323283..36324152|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:36321573..36324152
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:36321573..36324152
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggggagccagacaatggcgtcgaaggccggaggcgggggcgtcgcgcggcgcggaggagggcggatgcggagtctggggaggcagggatccatgtacagcctcaccctcgacgaggtgcagagccagctgggcgagccgctgcacagcatgaacctcgacgagctgctccggagcgtgttccctgacggcctggccatcgccgacggtgccggtgccaccaccagtagccagcagcatcagccgggctcgggcctcctgcggcaggggagcatcacgatgccgcctgagctcagcaagaagacggtggacgaggtgtggaaggggatccaggctgctccgaagaggaatgccgaaacgggcggcggcggcggcggaggtcgacggcggcgagagaggcagccgacgcttggggaggtgacgctcgaggatttcctggtcaaagctggggttgtcacccaaggatctctcaaggagcttagtgatgtaggcaatgtggatccggttggaagaggtgttacagcaaccgggactgtggatctggcacctggatcacactggatagagcagtataagcagcagattgcatctactgatgctcatcaccatgggcagcaaggtgtgcagggtgcttattttccgaatcgattggtccctcagccacttaatgttggccccggtgctattctggagccatcctactctgatggccagacttcttcaggaatgatcggcggaatgtccgattcgcagacgcctggaaggaagcgaggcatgtcaggggatgtggcagataagttgatggagagaaggcagaagaggatgatcaagaacagggagtcagctgcccgttcaagagccaggaagcaggcctacactaatgaacttgaaaacaaggtttctcgtttagaagaggagaatgtgaggctaaagaggcaaaaggagtcagactatttggagttggatgaattaatttgcgctgtgcctgtaccagaacccaagtatcaactcaggagaacaagctccgcagatttctga</cdnaseq>|
| |
| − | AA = <aaseq>MGSQTMASKAGGGGVARRGGGRMRSLGRQGSMYSLTLDEVQSQL GEPLHSMNLDELLRSVFPDGLAIADGAGATTSSQQHQPGSGLLRQGSITMPPELSKKT VDEVWKGIQAAPKRNAETGGGGGGGRRRRERQPTLGEVTLEDFLVKAGVVTQGSLKEL SDVGNVDPVGRGVTATGTVDLAPGSHWIEQYKQQIASTDAHHHGQQGVQGAYFPNRLV PQPLNVGPGAILEPSYSDGQTSSGMIGGMSDSQTPGRKRGMSGDVADKLMERRQKRMI KNRESAARSRARKQAYTNELENKVSRLEEENVRLKRQKESDYLELDELICAVPVPEPK YQLRRTSSADF</aaseq>|
| |
| − | DNA = <dnaseqindica>2500..2580#1253..1267#1043..1114#1..870#atggggagccagacaatggcgtcgaaggccggaggcgggggcgtcgcgcggcgcggaggagggcggatgcggagtctggggaggcagggatccatgtacagcctcaccctcgacgaggtgcagagccagctgggcgagccgctgcacagcatgaacctcgacgagctgctccggagcgtgttccctgacggcctggccatcgccgacggtgccggtgccaccaccagtagccagcagcatcagccgggctcgggcctcctgcggcaggggagcatcacgatgccgcctgagctcagcaagaagacggtggacgaggtgtggaaggggatccaggctgctccgaagaggaatgccgaaacgggcggcggcggcggcggaggtcgacggcggcgagagaggcagccgacgcttggggaggtgacgctcgaggatttcctggtcaaagctggggttgtcacccaaggatctctcaaggagcttagtgatgtaggcaatgtggatccggttggaagaggtgttacagcaaccgggactgtggatctggcacctggatcacactggatagagcagtataagcagcagattgcatctactgatgctcatcaccatgggcagcaaggtgtgcagggtgcttattttccgaatcgattggtccctcagccacttaatgttggccccggtgctattctggagccatcctactctgatggccagacttcttcaggaatgatcggcggaatgtccgattcgcagacgcctggaaggaagcgaggcatgtcaggggatgtggcagataagttgatggagagaaggcagaagaggatgatcaagaacagggagtcagctgcccgttcaagagccaggaagcaggtgcaatatgtgttttacacctttctatttgtggcaaatttttaattagcattgttcttgctgcatatgatgattaagaaggccactgttactttaaatttagtttcttcatgtgacctgtgagtttgtgtattacccacatgattgcataattacatttcatttgtgacaggcctacactaatgaacttgaaaacaaggtttctcgtttagaagaggagaatgtgaggctaaagaggcaaaaggtactgtcttttccactgcaattatatcagaatgttgcaaatttcccctatcaagtatttttccccggtgcatgcttgtcctataaattaaccaattaattcttccctaatttgtcttcactttctgcctctgaataggagtcagactatttggtaagtgacaggaaataaatactatcacttgtactgtctcttatgtctagtttttactatttcatattgtcaagctaccttgttgatatgtacttgtcatacatcactaagacccttttatggccttactacaccttatgatttttcaatgttttcacagctctataataataatataatcttaagtatttgcttccaccacttgaggtgactgtttttaggtaggactgtaggagtgagccatatactgttcattctattagttgatctaattattaggcatgtcccgtcaagcatttatttgagccagtatcttatttgtgcctgaagggaggaaactaattttctggtggatattgggggtatcttgtatttttccttaaatatcttcgaaaagactaccttatactattattcactctaagtcgataataaaatggggcagcattatactaggagtaatcttgtgatggaaaacatagaaatacatcgcagtctaatcaacagcaatattatcatctggtatgatgagctgtactacttcataggtagtgtatcaagttacaatcaagaggtcttcgtcatggtcattgtttgtgtgtaggaattgtcttctgcatgtcaacttttggatgactgtccaataaagtaacttcttacctatggcatttgaagaattctgcttgcagaatactgttgtggactctggttctaacatattgcatctctggttctaacatattgcatccctctgactaattggttagctcctcaaacaaagcagtgttagcaataaaagatattttctaagttattttgatcccattaaccctggatggccatgcgtcttttaagcatccttcgtactataggaagattagcaaggatccaacggactgaatcatgtccctggaaagctagaagtattaatctcatgtctatttatatttcatatttttctggtaccacattgtttcagtgcatctgatgtggcaagaaaattggcagtagtactcctttaatgataattcaaagttttagcacttgccactggatatcaatttagctagtactatatattatgctaattttgtgcttaatcctactatcagccaaacactgtcctgttccatatattttacaccatatatttttgtattctgatgatgccatattgggttacttatccatacacagcattgacttgttttcccctctcatgctatcttcaggagttggatgaattaatttgcgctgtgcctgtaccagaacccaagtatcaactcaggagaacaagctccgcagatttctga</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051133.2 RefSeq:Os01g0813100]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |
The rice Os01g0813100 was reported as OsbZIP09 in 2008 [1] by researchers from India.
Annotated Information
Gene Symbol
- Os01g0813100 <=> OsbZIP09,OsbZIP, bZIP09
Function
- The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
- The OsbZIP proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and
the Leu zipper dimerization region.
- bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction
and development, and photomorphogenesis, and are also involved in stress and hormone signaling.
Expression
- The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to
various stages of panicle and seed development.
- bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic
stress and light irradiation.
Evolution
- The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous
bZIP domains exist in plants.
- Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
- Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding
site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
You can also add sub-section(s) at will.
Labs working on this gene
- Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi
110021, India
References
- ↑
Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression
analysis of the basic leucine zipper transcription factor family in rice. Plant
Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID:
PMC2245831.
Structured Information
