|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os01g0867300''''' was reported as '''''OsbZIP012''''' in 2008 <ref name="ref1" /> by researchers from India. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0867300''''' '''<=>''' '''''OsbZIP012,OsbZIP, bZIP012''''' |
| | ===Function=== | | ===Function=== |
| − | bZIP transcription factor OsABF1 is an ABA response element combination factor, which can enhance signal transduction of abiotic stress in rice. The bZIP transcription factors are considered playing a role in stress signaling of plant.OsABF1 is a gene which as combination factor to response abscisic acid , and encoding bZIP transcription factors.Therefore,OsABF1 is involved in rice abiotic stress responses and ABA signaling. | + | * The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes. |
| | + | * The '''''OsbZIP''''' proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region. |
| | + | * bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | OsABF1 expression in seeding shoot and root was induced by all kinds of abiotic stress such as oxygen deficit,salt,drought,oxidation,cold and ABA,but undetectable expression when untreated.OsABF1 is a nuclear protein, which can combine the ABA responsive elements(ABREs),and the N-terminal region is necessary for trans-activating report gene of downstream. Compared with the wide type, the homozygous for the T-DNA insertion mutant gene Osabf1-1 and Osabf1-2 are more sensitive to drought and salt treatment,in addition,some gene that upregulated ABA stress regulating responsive gene under ABA treatment was suppressed in Osabf1 mutant. Therefore,OsABF1 is involved in rice abiotic stress responses and ABA signaling.
| + | * The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development. |
| | + | * bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | * The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants. |
| − | | + | * Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains. |
| − | You can also add sub-section(s) at will. | + | * Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively. |
| | + | <br> |
| | + | '''''You can also add sub-section(s) at will.''''' |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Department of Bioscience and Biotechnology, The University of Suwon, Korea. | + | * Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India |
| − | Graduate School of Biotechnology & Plant Metabolism Research Center, Kyung Hee University, Korea.
| |
| | | | |
| | ==References== | | ==References== |
| − | 1. Md. Amir Hossain;Yongjoo Lee;Jung-Il Cho;Chul-Hyun Ahn;Sang-Kyu Lee;Jong-Seong Jeon;Hun Kang;Choon-Hwan Lee;Gynheung An;Phun Bum Park
| + | <references> |
| − | The bZIP transcription factor OsABF1 is an ABA responsive element binding factor that enhances abiotic stress signaling in rice
| + | * <ref name="ref1"> |
| − | Plant Molecular Biology, 2010, 72(4-5): 557-566
| + | Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression |
| − | 2. Qian Ji;Liang-sheng Zhang;Yi-fei Wang;Jian Wang
| + | analysis of the basic leucine zipper transcription factor family in rice. Plant |
| − | Genome-wide analysis of basic leucine zipper transcription factor families in Arabidopsis thaliana, Oryza sativa and Populus trichocarpa
| + | Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID: |
| − | Journal of Shanghai University (English Edition), 2009, 13(2): 174-182
| + | PMC2245831. |
| − | 3. Aashima Nijhawan;Mukesh Jain;Akhilesh K. Tyagi;Jitendra P. Khurana
| + | </ref> |
| − | Genomic Survey and Gene Expression Analysis of the Basic Leucine Zipper Transcription Factor Family in Rice
| + | </references> |
| − | Plant Physiology, 2008, 146(2): 333-350
| + | |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]] |
| − | GeneName = Os01g0867300|
| |
| − | Description = Similar to OSE2-like protein (Fragment)|
| |
| − | Version = NM_001051448.1 GI:115441266 GeneID:4325078|
| |
| − | Length = 3398 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0867300, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:39312554..39315951|
| |
| − | CDS = 39313018..39313098,39314010..39314039,39314794..39314865,39314961..39315578|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:39312554..39315951
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:39312554..39315951
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgatggcgtcgagggtgatggcgtcgtcgtcgccgtcgcacacggcatcggatctcgcgcggttcgcggcggggaggggtgggggcgggagcgcggggctggggtcgatgaacgtggaggagatcctccgcggcatctacgccgacatgccgacgccggcgctgcccctcgtcggcggtgacaggccgatgtcgccgctcccggcgccggatgtcgccgccgcgccgcggacggcggaggaggtctggaaggagataactggtgcgggcgtcgccgccgccgccggcggcgtggtgccccctgctgctgctgctgctgctgccccggccgtcgtcgctggcgctggcgctggcaccggcgcggagatgacgctggaggactttctggcgagggagggcgcggtgaaggaagacgaggctgtggtcaccgatccctcggcggccaaggggcaggtggtgatggggttcctgaacggggcagaggtcaccggaggcgtcaccggcggcaggagcaggaagaggcacctgatggatccgatggaccgcgccgcgatgcagcggcagaagcgaatgatcaaaaatcgcgagtcggcggcgaggtcacgggagaggaagcaggcctatattgctgagctcgagtcgctggtcacgcaactcgaggaggagaacgccaagatgttcaaagaacaggaggagcaacatcagaaacgacttaaagagctcaaggaaatggttgttccagtcatcattaggaaaacgtcagcacgagatcttagaagaacaaactcgatggagtggtag</cdnaseq>|
| |
| − | AA = <aaseq>MMASRVMASSSPSHTASDLARFAAGRGGGGSAGLGSMNVEEILR GIYADMPTPALPLVGGDRPMSPLPAPDVAAAPRTAEEVWKEITGAGVAAAAGGVVPPA AAAAAAPAVVAGAGAGTGAEMTLEDFLAREGAVKEDEAVVTDPSAAKGQVVMGFLNGA EVTGGVTGGRSRKRHLMDPMDRAAMQRQKRMIKNRESAARSRERKQAYIAELESLVTQ LEEENAKMFKEQEEQHQKRLKELKEMVVPVIIRKTSARDLRRTNSMEW</aaseq>|
| |
| − | DNA = <dnaseqindica>2854..2934#1913..1942#1087..1158#374..991#attaacctctaaaccataaagtccccccgtctcatgtcgtctcatcactcacttataatcacccccatccacttaatcacgctctcaacgctgctgtgtcacgtcacgtcacgcgcggctccgtaataagaccaccaacctcctcctcctccctcccacgtttggagctctcgtctcgtctcgcggcctcgagccctcgaccaaccaaccacccgcttcttctctcccgtctcccgaaacctccgagagctcagaagaaaaaagaagaaaaaaaagagaaaaaaaaactggtggaaactggaaggtttgcggcggaaacgagggggagggatggtggcgaggagggcgtaggcggggggtgggggtgaggcggatgatggcgtcgagggtgatggcgtcgtcgtcgccgtcgcacacggcatcggatctcgcgcggttcgcggcggggaggggtgggggcgggagcgcggggctggggtcgatgaacgtggaggagatcctccgcggcatctacgccgacatgccgacgccggcgctgcccctcgtcggcggtgacaggccgatgtcgccgctcccggcgccggatgtcgccgccgcgccgcggacggcggaggaggtctggaaggagataactggtgcgggcgtcgccgccgccgccggcggcgtggtgccccctgctgctgctgctgctgctgccccggccgtcgtcgctggcgctggcgctggcaccggcgcggagatgacgctggaggactttctggcgagggagggcgcggtgaaggaagacgaggctgtggtcaccgatccctcggcggccaaggggcaggtggtgatggggttcctgaacggggcagaggtcaccggaggcgtcaccggcggcaggagcaggaagaggcacctgatggatccgatggaccgcgccgcgatgcagcggcagaagcgaatgatcaaaaatcgcgagtcggcggcgaggtcacgggagaggaagcaggtgggtgtggaaactgtgcatttttacaagctttcgttcgccctaggaatttgagttatactgagaaggctgacgtcttctttttgttggtgaaggcctatattgctgagctcgagtcgctggtcacgcaactcgaggaggagaacgccaagatgttcaaagaacaggtacttctccgagaccccgacatttctcgtgtgcttgtttgatgttggaaacttgaatgtggggattcgtgtgttgagaattgaaccgtgtctccattgtttattgagcttaaacttgcagaaatgtttctgttaaatctctaggtgagtaggcatgtgaccatgaacatgttagaactgcaacagagttgggctgtggagccaaaatgaattgcaagtagtattcgtttttgttagccatctgcttaggatgccatttgccgtggtaaattttttaaaggaaaatgcttcgcatacaacaatcatatactagtgcaccaagcagcacacgctgttcggctgttcggtacagcggccacgctacagccaattgctacaccaagcagcacagccgctgcactaagcttgctgccgcacagcgctgcatcaagcagccgaacacggcatatgcatattaaaactcatctcattcgctgcctttgatgtattctcgcttttccttcttggaaaaggtctccctataaaatttgtagtgtgtacagaagttgtctgaaagaagtgttattcactatactcaccttttgttcttgtctccatttcccctgtccattttaatttagaatttcatactgtgcctacacggttacggctggattgtgcatgacttgcttataactaatcaaggatggcataagttactcttcttggtcttctagcaatttccttacgataaactccctcgcatgtgtttcaggaggagcaacatcagaaacgacttaaagaggtaagctttgtaagatggtgttgcctttaattatctagtgctttagagcatttgtgttaagtgccatatcccaaaaaaaacttcacccacaacgcatgccctggaggggaaaaaagaacatcgtcttgtgaaaatcttgtaatcaatcctggatcagccttcatataggaacatacagtacagaacacaatactgggtaagtatacactggattattccgtattcgttggatatgatactccaaacaggagatgctttttagccttcccactagcctgcaccaagtggcttggcaaacaaacaataggtgatgctgacacctttcgatggcatcagcacaagtgcacaacacatgttgagttttgagattgtctacctcatccatttctttcttgggagcctgttcaactcattatagatgcattgcatgtatatatgtctgattaaaaaggcctgagcctgcagttccgtgcttttccaccacggcacagcttgccaggttgaagcagtatatagttataaattgtcttcttttgtcactatcagggaggttgggttgagagggagatgctttgtcaatttggttgtataagttgcatcgtaggcacagttgagcccacatcttgcttaggaacagttcgcctccatttggctttgcatactatagttgtcttccatttagttttcagccagcataggatttcagatttcttctaattttgcctttcctgcctggattgtatatattgatttatatatatcttgacgacctgcctctcatcgttggtgcagaggccgaattccattatccaaaaaaaaaaaaaaatcttttgcaaatctatatgctcattaactcattcattaggttcatcgatcatgcttatctgaagaaatctgtttactttatgcagctcaaggaaatggttgttccagtcatcattaggaaaacgtcagcacgagatcttagaagaacaaactcgatggagtggtagacgtgagccaagctcagttgccatccccatacagtttatgtagcatttgctcctgttttgtcaattcttctgttttatcggcagtagcctagttgcggtgaatacatgagtatttaggtgacacgaagcttaaatgtctggagtcatatgctacggaggggagagtgcgtacgagctacaaaagcaatcatatgtgtagggaggggagagtgcatatgagctataaaagccatgttccaatttgtcgcgggagtgtattctgtcccatttgttgtctgtttcattttcagtttaacaattaggtgtagtgaggaagaattacgagtactgagtagtactaaacagggtgactctaggtatgctgatatgatatctagttaggcattacttctgattctctgtttggtgccacgactcaaattgtctgtacatacacgttggatgtaaagtcacattatcaagtg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051448.1 RefSeq:Os01g0867300]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |