Difference between revisions of "Os09g0522200"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0522200''''' was reported as '''''OsDREB1A''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os09g0522200''''' '''<=>''' '''''OsDREB1A,CBF3, OsCBF3, OsDREB1A/OsCBF3, ERF24, OsERF24'''''
 +
 
===Function===
 
===Function===
Os09g0522200(''OsDREB1A'') is one of the five ''OsDREB'' genes( ''OsDREB1A'', ''OsDREB1B'', ''OsDREB1C'', ''OsDREB1D'', and ''OsDREB2A'') in rice, Oryza sativa L. isolated by Dubouzet et al for ''DREB'' homologs. The transcription factors DREBs/CBFs specifically interact with the dehydration-responsive element/Crepeat (DRE/CRT) cis-acting element (core motif: G/ACCGAC) and control the expression of many stress-inducible genes in Arabidopsis. To compare the function of ''OsDREB1A'' with that of ''DREB1A'', we generated transgenic plants in which the ''OsDREB1A'' cDNA was over-expressed (35S:OsDREB1A).The tolerance to freezing and high-salt stresses of the 35S:OsDREB1A plants was compared with those of the wild-type and 35S:DREB1Ac plants which had the lowest level of stress tolerance among the 35S:DREB1A transgenic Arabidopsis plants.Over-expression of OsDREB1A in transgenic Arabidopsis induced overexpression of target stress-inducible genes of Arabidopsis DREB1A resulting in plants with higher tolerance to drought, high-salt, and freezing stresses. This indicated that ''OsDREB1A'' has functional similarity to ''DREB1A''. However, in microarray and RNA blot analyses, some stress-inducible target genes of the ''DREB1A'' proteins that have only ACCGAC as DRE were not over-expressed in the ''OsDREB1A'' transgenic Arabidopsis. The ''OsDREB1A'' protein bound to GCCGAC more preferentially than to ACCGAC whereas the ''DREB1A'' proteins bound to both GCCGAC and ACCGAC efficiently. ''OsDREB1A'' is potentially useful for producing transgenic monocots that are tolerant to drought, high-salt, and/or cold stresses.
+
* The transcription factors dehydration-responsive element-binding protein 1s (DREB1s)/C-repeat-binding factors (CBFs) specifically interact with the DRE/CRT cis-acting element and control the expression of many stress-inducible genes in Arabidopsis.
 
+
* The genes for DREB1 orthologs, '''''OsDREB1A''''' and '''''OsDREB1B''''' from rice, are induced by cold stress, and overexpression of DREB1 or OsDREB1 induced strong expression of stress-responsive genes in transgenic Arabidopsis plants, resulting in increased tolerance to high-salt and freezing stresses.
 +
* '''''OsDREB1A''''' contained an open reading frame of 238 amino acids and encoded a putative protein with a predicted molecular mass of 25.6 kDa.
 
===Expression===
 
===Expression===
The expression patterns of the ''OsDREB'' genes were analyzed by RNA-gel blot hybridization. The ''OsDREB1A'' genes were not responsive to exposure to ABA but they were induced within 40 min after exposure to cold stress. ''OsDREB1A'' was also induced within 5 h after salt treatment and was transiently expressed in wounded seedlings.
+
* The expression patterns of the ''OsDREB'' genes were analyzed by RNA-gel blot hybridization.
 +
* The ''OsDREB1A'' genes were not responsive to exposure to ABA but they were induced within 40 min after exposure to cold stress.  
 +
* ''OsDREB1A'' was also induced within 5 h after salt treatment and was transiently expressed in wounded seedlings.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The analyses of the similarities of the ERF/AP2 domains of the ''OsDREB'' proteins and compared them with those in Arabidopsis and other genera.  
 
+
* The '''''OsDREB1''''' proteins were classified into the A-1 (DREB1/CBF) subgroup which is one of five groups of ERF/AP2-related proteins– AP2 subfamily,RAV subfamily, DREB subfamily, ERF subfamily, and one very specific gene, AL079349.
You can also add sub-section(s) at will.
+
* The DREB1-type ERF/AP2 domains in the three monocots were closely related to each other but distant from those in the dicots.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), Japan.
 +
*Key Laboratory of Agro-Ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K,
 +
Yamaguchi-Shinozaki K. Functional analysis of rice DREB1/CBF-type transcription
 +
factors involved in cold-responsive gene expression in transgenic rice. Plant
 +
Cell Physiol. 2006 Jan;47(1):141-53. PubMed PMID: 16284406.
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0522200|
 
Description = DRE-binding protein 1A|
 
Version = NM_001070247.1 GI:115480236 GeneID:4347620|
 
Length = 920 bp|
 
Definition = Oryza sativa Japonica Group Os09g0522200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:21146055..21146974|
 
CDS = 21146179..21146895|
 
GCID = <gbrowseImage1>
 
name=NC_008402:21146055..21146974
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:21146055..21146974
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtgcgggatcaagcaggagatgagcggcgagtcgtcggggtcgccgtgcagctcggcgtcggcggagcggcagcaccagacggtgtggacggcgccgccgaagaggccggcggggcggaccaagttcagggagacgaggcacccggtgttccgcggcgtgcggcggaggggcaatgccgggaggtgggtgtgcgaggtgcgggtgcccgggcggcgcggctgcaggctctggctcggcacgttcgacaccgccgagggcgcggcgcgcgcgcacgacgccgccatgctcgccatcaacgccggcggcggcggcggcgggggagcatgctgcctcaacttcgccgactccgcgtggctcctcgccgtgccgcgctcctaccgcaccctcgccgacgtccgccacgccgtcgccgaggccgtcgaggacttcttccggcgccgcctcgccgacgacgcgctgtccgccacgtcgtcgtcctcgacgacgccgtccaccccacgcaccgacgacgacgaggagtccgccgccaccgacggcgacgagtcctcctccccggccagcgacctggcgttcgaactggacgtcctgagtgacatgggctgggacctgtactacgcgagcttggcgcaggggatgctcatggagccaccatcggcggcgctcggcgacgacggtgacgccatcctcgccgacgtcccactctggagctactag</cdnaseq>|
 
AA = <aaseq>MCGIKQEMSGESSGSPCSSASAERQHQTVWTAPPKRPAGRTKFR                    ETRHPVFRGVRRRGNAGRWVCEVRVPGRRGCRLWLGTFDTAEGAARAHDAAMLAINAG                    GGGGGGACCLNFADSAWLLAVPRSYRTLADVRHAVAEAVEDFFRRRLADDALSATSSS                    STTPSTPRTDDDEESAATDGDESSSPASDLAFELDVLSDMGWDLYYASLAQGMLMEPP                    SAALGDDGDAILADVPLWSY</aaseq>|
 
DNA = <dnaseqindica>80..796#atcgccattaccacactcgagcagagcaaatacagttcaggaatcaggagcaagcagaaacacacacacaaatccgaagatgtgcgggatcaagcaggagatgagcggcgagtcgtcggggtcgccgtgcagctcggcgtcggcggagcggcagcaccagacggtgtggacggcgccgccgaagaggccggcggggcggaccaagttcagggagacgaggcacccggtgttccgcggcgtgcggcggaggggcaatgccgggaggtgggtgtgcgaggtgcgggtgcccgggcggcgcggctgcaggctctggctcggcacgttcgacaccgccgagggcgcggcgcgcgcgcacgacgccgccatgctcgccatcaacgccggcggcggcggcggcgggggagcatgctgcctcaacttcgccgactccgcgtggctcctcgccgtgccgcgctcctaccgcaccctcgccgacgtccgccacgccgtcgccgaggccgtcgaggacttcttccggcgccgcctcgccgacgacgcgctgtccgccacgtcgtcgtcctcgacgacgccgtccaccccacgcaccgacgacgacgaggagtccgccgccaccgacggcgacgagtcctcctccccggccagcgacctggcgttcgaactggacgtcctgagtgacatgggctgggacctgtactacgcgagcttggcgcaggggatgctcatggagccaccatcggcggcgctcggcgacgacggtgacgccatcctcgccgacgtcccactctggagctactagagctcaatcaactgtacaattttgcctcttttttctctcttttctggcttccgatgccaaaattttggtactgtacggacactactttcggtaatgtgatggaacaagttgcaaaacacagagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070247.1 RefSeq:Os09g0522200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:49, 23 February 2017

The rice Os09g0522200 was reported as OsDREB1A in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os09g0522200 <=> OsDREB1A,CBF3, OsCBF3, OsDREB1A/OsCBF3, ERF24, OsERF24

Function

  • The transcription factors dehydration-responsive element-binding protein 1s (DREB1s)/C-repeat-binding factors (CBFs) specifically interact with the DRE/CRT cis-acting element and control the expression of many stress-inducible genes in Arabidopsis.
  • The genes for DREB1 orthologs, OsDREB1A and OsDREB1B from rice, are induced by cold stress, and overexpression of DREB1 or OsDREB1 induced strong expression of stress-responsive genes in transgenic Arabidopsis plants, resulting in increased tolerance to high-salt and freezing stresses.
  • OsDREB1A contained an open reading frame of 238 amino acids and encoded a putative protein with a predicted molecular mass of 25.6 kDa.

Expression

  • The expression patterns of the OsDREB genes were analyzed by RNA-gel blot hybridization.
  • The OsDREB1A genes were not responsive to exposure to ABA but they were induced within 40 min after exposure to cold stress.
  • OsDREB1A was also induced within 5 h after salt treatment and was transiently expressed in wounded seedlings.

Evolution

  • The analyses of the similarities of the ERF/AP2 domains of the OsDREB proteins and compared them with those in Arabidopsis and other genera.
  • The OsDREB1 proteins were classified into the A-1 (DREB1/CBF) subgroup which is one of five groups of ERF/AP2-related proteins– AP2 subfamily,RAV subfamily, DREB subfamily, ERF subfamily, and one very specific gene, AL079349.
  • The DREB1-type ERF/AP2 domains in the three monocots were closely related to each other but distant from those in the dicots.

Labs working on this gene

  • Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), Japan.
  • Key Laboratory of Agro-Ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, China

References

  1. Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol. 2006 Jan;47(1):141-53. PubMed PMID: 16284406.

Structured Information