Difference between revisions of "Os03g0809200"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0809200''''' was reported as '''''OsbZIP34''''' in 2008 <ref name="ref1" /> by researchers from India.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os03g0809200''''' '''<=>''' '''''OsbZIP34,OsbZIP, bZIP34'''''
 
===Function===
 
===Function===
Please input function information here.
+
* The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
 +
* The '''''OsbZIP''''' proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
 +
* bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
 +
* bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.  
 
+
* Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
You can also add sub-section(s) at will.
+
* Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
 +
<br>
 +
'''''You can also add sub-section(s) at will.'''''
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression
 +
analysis of the basic leucine zipper transcription factor family in rice. Plant
 +
Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID:
 +
PMC2245831.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]]
GeneName = Os03g0809200|
 
Description = Similar to Transcription factor EmBP-1 (Fragment)|
 
Version = NM_001058191.1 GI:115456110 GeneID:4334523|
 
Length = 1358 bp|
 
Definition = Oryza sativa Japonica Group Os03g0809200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:34694956..34696313|
 
CDS = 34695505..34695672,34695814..34695942|
 
GCID = <gbrowseImage1>
 
name=NC_008396:34694956..34696313
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:34694956..34696313
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>caaagctttcttattgattatgtattcttgttacactgccagcaagaatgtgaggagttgtcccagaaggtaactgaactgacagccgtaaacagcacactcatgacagaactcgacaagcttaagaaggactgtgaagacatggaagcggaaaattcgcagctaatggatgagatggtgcagtccgagggctctagtgttatagccactttgagcgtcaagattgacacgtcaaaagaccgccatggtagcagtagccagctaaataagcacacaaatgatgacagcaaagggtag</cdnaseq>|
 
AA = <aaseq>QSFLIDYVFLLHCQQECEELSQKVTELTAVNSTLMTELDKLKKD                    CEDMEAENSQLMDEMVQSEGSSVIATLSVKIDTSKDRHGSSSQLNKHTNDDSKG</aaseq>|
 
DNA = <dnaseqindica>550..717#859..987#gtagggtctctgatagataagactagtttcttgccacatgagaatgctgcatcttggtagtatgttatcctgtttgcgacatctcaaatggccactgttggatttatgatccaggaaagacccacatctttctgtcacccgccaaactatcctgttactttttatggcctgacaaacgtaagaaaatacttgctcagggaaagttaccaaccatctataaaccttgggtaaggagatatattttatttttgagatgctttctactgttgccgggactcttggcttgattatatttggaaggttgagctgttaaccttgctgtccaggctgcccctataacattttaagaactgataaattacaaatctgaaatttcacaaacacattcggtcatccactctggcaccttgggacacaatttatttgattttctaggtcaatgagagagccatttttcatgactagttagtggtatagaacaagtttagatttatcaaattccacattttcttatggaaaacaaagctttcttcttctttttttgactaacaaagctttcttattgattatgtattcttgttacactgccagcaagaatgtgaggagttgtcccagaaggtaactgaactgacagccgtaaacagcacactcatgacagaactcgacaagcttaagaaggactgtgaagacatggaagcggaaaattcgcagctaatggtgaacaccaatcccctctttactcgtattttgccatgtgatcatatcagaagaattctaccctatgttccaaagttatccttgtaatagctagcatctcacttctcagtttctcactatgaacctttggggctttggcaggatgagatggtgcagtccgagggctctagtgttatagccactttgagcgtcaagattgacacgtcaaaagaccgccatggtagcagtagccagctaaataagcacacaaatgatgacagcaaagggtagtttgattgattgagaacatgaactggaggttaactctactctactgagaccatgagacgatgtgctttagccgcttattgttacccccatcaccatcagcttgttggtcattgctttctggagctaccatcgtgtgtgatatcgagttttcgtcacctcatgctttcgtgagggacctgtaaattgtcaagcggtacagctagttagtattagttaagtggctaagccaccgagaagtgtgtactccaattgatattatttctgtaatacctgagccttattatagttgcggacttcttgcgataatggacagtttttgagtcctgatggttcagtgatcaataatattatggaaatacaaacatcatttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058191.1 RefSeq:Os03g0809200]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 07:08, 24 February 2017

The rice Os03g0809200 was reported as OsbZIP34 in 2008 [1] by researchers from India.

Annotated Information

Gene Symbol

  • Os03g0809200 <=> OsbZIP34,OsbZIP, bZIP34

Function

  • The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
  • The OsbZIP proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
  • bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.

Expression

  • The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
  • bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.

Evolution

  • The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.
  • Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
  • Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.


You can also add sub-section(s) at will.

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India

References

  1. Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice. Plant Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID: PMC2245831.


Structured Information