Difference between revisions of "Os08g0549600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os08g0549600| Description = Basic-leucine zipper (bZIP) transcription factor domain containing protein| Version = NM_001188757.1 GI:297726644 Gen...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os08g0549600''''' was reported as '''''OsbZIP69''''' in 2008 <ref name="ref1" /> by researchers from India.  
GeneName = Os08g0549600|
 
Description = Basic-leucine zipper (bZIP) transcription factor domain containing protein|
 
Version = NM_001188757.1 GI:297726644 GeneID:9272719|
 
Length = 525 bp|
 
Definition = Oryza sativa Japonica Group Os08g0549600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os08g0549600''''' '''<=>''' '''''OsbZIP69,OsbZIP, bZIP69'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Function===
|
+
* The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
+
* The '''''OsbZIP''''' proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
AP = Chromosome 8:27664181..27664705|
+
* bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.
CDS = 27664181..27664534,27664619..27664705|
+
 
GCID = <gbrowseImage1>
+
===Expression===
name=NC_008401:27664181..27664705
+
* The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
source=RiceChromosome08
+
* bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.
preset=GeneLocation
+
 
</gbrowseImage1>|
+
===Evolution===
GSID = <gbrowseImage2>
+
* The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.  
name=NC_008401:27664181..27664705
+
* Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.  
source=RiceChromosome08
+
* Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
preset=GeneLocation
+
<br>
</gbrowseImage2>|
+
'''''You can also add sub-section(s) at will.'''''
CDNA = <cdnaseq>atggagcgagcggctggtactggtagcggcggcgacgatgacgagctcgtgctgccgccggcgtcgtttcaggacgggcttccgtcgtcccgctcctacccctcctgcatcggcggcggtagcgcagcggcggcgtcggcgtcgctggagcgggagctgctgtaccgcgcggagctgcaccagcaacagctgggcggcggcggcggcgtagagcggcggaagaggcgcgcgatgaagaaccgcgagtcggcggagcggtcgcgcgcgcggaagcaggcgtacctgcaggagctcgagcaggaggtccgcctcctccgcgccgagaacgccgccctgcgccaccagtgccaccagctgaaggccgccgcggcggaggcggaggcggaggcggcggcagcggcggcggcggcgaagaagccgacgtcgtcggcgacgttctga</cdnaseq>|
+
 
AA = <aaseq>MERAAGTGSGGDDDELVLPPASFQDGLPSSRSYPSCIGGGSAAA                    ASASLERELLYRAELHQQQLGGGGGVERRKRRAMKNRESAERSRARKQAYLQELEQEV                    RLLRAENAALRHQCHQLKAAAAEAEAEAAAAAAAAKKPTSSATF</aaseq>|
+
==Labs working on this gene==
DNA = <dnaseqindica>1..354#439..525#atggagcgagcggctggtactggtagcggcggcgacgatgacgagctcgtgctgccgccggcgtcgtttcaggacgggcttccgtcgtcccgctcctacccctcctgcatcggcggcggtagcgcagcggcggcgtcggcgtcgctggagcgggagctgctgtaccgcgcggagctgcaccagcaacagctgggcggcggcggcggcgtagagcggcggaagaggcgcgcgatgaagaaccgcgagtcggcggagcggtcgcgcgcgcggaagcaggcgtacctgcaggagctcgagcaggaggtccgcctcctccgcgccgagaacgccgccctgcgccaccagtgccaccaggtacgtactaccctatcgtctccttccttccttcgtcgtcagactctgtgtgctcatagatcgacgtgttgatgagatgtgcagctgaaggccgccgcggcggaggcggaggcggaggcggcggcagcggcggcggcggcgaagaagccgacgtcgtcggcgacgttctga</dnaseqindica>|
+
* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188757.1 RefSeq:Os08g0549600]|
+
 
}}
+
==References==
[[Category:Genes]]
+
<references>
[[Category:Japonica mRNA]]
+
* <ref name="ref1">
[[Category:Oryza Sativa Japonica Group]]
+
Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression
[[Category:Japonica Genes]]
+
analysis of the basic leucine zipper transcription factor family in rice. Plant
[[Category:Japonica Chromosome 8]]
+
Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID:
[[Category:Chromosome 8]]
+
PMC2245831.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 8]]

Latest revision as of 05:08, 25 February 2017

The rice Os08g0549600 was reported as OsbZIP69 in 2008 [1] by researchers from India.

Annotated Information

Gene Symbol

  • Os08g0549600 <=> OsbZIP69,OsbZIP, bZIP69

Function

  • The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
  • The OsbZIP proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
  • bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.

Expression

  • The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
  • bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.

Evolution

  • The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.
  • Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
  • Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.


You can also add sub-section(s) at will.

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India

References

  1. Nijhawan A, Jain M, Tyagi AK, Khurana JP. Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice. Plant Physiol. 2008 Feb;146(2):333-50. PubMed PMID: 18065552; PubMed Central PMCID: PMC2245831.

Structured Information