Difference between revisions of "Os06g0226500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os06g0226500| Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein| Version = NM_001063738.1 GI:115467207 Gene...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os06g0226500''''' was reported as '''''BU1''''' in 2009 <ref name="ref1" /> by researchers from Japan.  
GeneName = Os06g0226500|
 
Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
 
Version = NM_001063738.1 GI:115467207 GeneID:4340551|
 
Length = 1052 bp|
 
Definition = Oryza sativa Japonica Group Os06g0226500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os06g0226500''''' '''''<=>''''' '''''ILI4, OsBU1 '''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
+
* Brassinosteroids (BRs) are involved in many developmental processes and regulate many subsets of downstream genes throughout the plant kingdom.
AP = Chromosome 6:6555698..6556749|
+
* The rice '''''BRASSINOSTEROID UPREGULATED1 (BU1)''''' is a novel BR-induced gene encoding a helix-loop-helix protein.
CDS = 6555803..6555913,6556168..6556320|
+
* '''''BU1''''' protein is a positive regulator of BR response: it controls bending of the lamina joint in rice and it is a novel primary response gene that participates in two BR signaling pathways through '''''OsBRI1''''' and '''''RGA1'''''.
GCID = <gbrowseImage1>
+
* '''''BU1''''' may participate in some other unknown processes modulated by BR in rice.
name=NC_008399:6555698..6556749
+
 
source=RiceChromosome06
+
===Phenotypic analysis===
preset=GeneLocation
+
* Rice plants overexpressing '''''BU1'''''(BU1:OX) showed enhanced bending of the lamina joint, increased grain size, and resistance to brassinazole, an inhibitor of BR biosynthesis.
</gbrowseImage1>|
+
* In contrast to BU1:OX, RNAi plants designed to repress both BU1 and its homologs displayed erect leaves.
GSID = <gbrowseImage2>
+
* In addition, compared to the wild type, the induction of BU1 by exogenous brassinolide did not require de novo protein synthesis and it was weaker in a BR receptor mutant OsbriI (Oryza sativa brassinosteroid insensitive1, d61) and a rice G protein alpha subunit (RGA1) mutant d1.
name=NC_008399:6555698..6556749
+
 
source=RiceChromosome06
+
===Expression===
preset=GeneLocation
+
* Expression analyses showed that BU1 is expressed in several organs including lamina joint, phloem, and epithelial cells in embryos.
</gbrowseImage2>|
+
 
CDNA = <cdnaseq>atgtcgagccggaggtcgtcgcgctcctccgtgtcggaggaggagatcaacgagctcatctccaagctccagtccctcctccccagctcccgccgccgcggcgccaaccaggcgtcgacgacgaagctgctgaaggagacgtgcagctacatcaagagcctgcaccgggaggtggacgacctcagcgacaggctctccgacctcatggccggcatggatcacaacagcccaggcgccgagatcatccgcagcctcctccgctag</cdnaseq>|
+
You can also add sub-section(s) at will.
AA = <aaseq>MSSRRSSRSSVSEEEINELISKLQSLLPSSRRRGANQASTTKLL                    KETCSYIKSLHREVDDLSDRLSDLMAGMDHNSPGAEIIRSLLR</aaseq>|
+
 
DNA = <dnaseqindica>106..216#471..623#aattcctacctcacacttctgcaacaagctttagctccagccaccggaacgagagatcgatacagctcgatcagctagccgcattcgccctcgccgccgccgacgatgtcgagccggaggtcgtcgcgctcctccgtgtcggaggaggagatcaacgagctcatctccaagctccagtccctcctccccagctcccgccgccgcggcgccaaccaggtactacatttcaccgttctcatcaccacaagttcacataaccaccatgcacactagcggcatgaacaagctagctacatgagtgatcgacgatgtgtagatttgtcggggttctaaatcttcggctacagctgtttgagaagggtctagctatttaaccactatagagggtctgccgttaaatgtgttagcccgctatttaaaactctctaattaattattgttgttaatggcggatgcaaaataaaatgcaggcgtcgacgacgaagctgctgaaggagacgtgcagctacatcaagagcctgcaccgggaggtggacgacctcagcgacaggctctccgacctcatggccggcatggatcacaacagcccaggcgccgagatcatccgcagcctcctccgctagctcatctcttctcatctgttcttcctcctcgatgatcgatcgatctcgtgttattctacgtacatgaaggatgatatgaatgcagctcgtgccctgtagctacgtataaatatacacatatgtatacatgcatacagtacatgatatgcatatgcctagatctgatctagctcagtagaaaatctactcatctcggtgtactactgatgatgatgatgattaaggcatgcagctggcttgatgatcggtactactactactacttcacttcagttcagtaggggcattagctagctagctagggccggctgcctaattaagtaattaagtaatttattatttgtagtagccagcttgatctcatctctcctcatgagccatatgacatgtggttaagttaattaatccttgatgcagtagagtcgtccc</dnaseqindica>|
+
==Labs working on this gene==
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063738.1 RefSeq:Os06g0226500]|
+
* Disease Resistance Research Unit (A.T., H.N., C.T., M.O., C.-J.J., J.G.D., M.M.) and Plant Genome Research Unit (S.K.), National Institute of Agrobiological Sciences, Tsukuba 305–8602, Japan;
}}
+
* Graduate School of Science and Technology, Tokyo University of Science, Noda 278–8510, Japan (A.T., T.K.);
[[Category:Genes]]
+
* Institute of Society for Techno-Innovation of Agriculture, Forestry and Fisheries, Tsukuba 305–0854, Japan (Z.S.); Faculty of Agriculture, Utsunomiya University, Utsunomiya 321–8505, Japan (C.T., H.S.);
[[Category:Japonica mRNA]]
+
* Department of Bioscience, Teikyo University, Utsunomiya 320–8551, Japan (T.N., T.Y.); a
[[Category:Oryza Sativa Japonica Group]]
+
* Department of Applied Biological Chemistry, University of Tokyo, Tokyo 113–8657, Japan (T.A.)
[[Category:Japonica Genes]]
+
 
[[Category:Japonica Chromosome 6]]
+
==References==
[[Category:Chromosome 6]]
+
<references>
 +
* <ref name="ref1">
 +
Tanaka A, Nakagawa H, Tomita C, Shimatani Z, Ohtake M, Nomura T, Jiang CJ,
 +
Dubouzet JG, Kikuchi S, Sekimoto H, Yokota T, Asami T, Kamakura T, Mori M.
 +
BRASSINOSTEROID UPREGULATED1, encoding a helix-loop-helix protein, is a novel
 +
gene involved in brassinosteroid signaling and controls bending of the lamina
 +
joint in rice. Plant Physiol. 2009 Oct;151(2):669-80. doi: 10.1104/pp.109.140806.
 +
PubMed PMID: 19648232; PubMed Central PMCID: PMC2754635.
 +
 
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]

Latest revision as of 12:09, 2 March 2017

The rice Os06g0226500 was reported as BU1 in 2009 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os06g0226500 <=> ILI4, OsBU1

Function

  • Brassinosteroids (BRs) are involved in many developmental processes and regulate many subsets of downstream genes throughout the plant kingdom.
  • The rice BRASSINOSTEROID UPREGULATED1 (BU1) is a novel BR-induced gene encoding a helix-loop-helix protein.
  • BU1 protein is a positive regulator of BR response: it controls bending of the lamina joint in rice and it is a novel primary response gene that participates in two BR signaling pathways through OsBRI1 and RGA1.
  • BU1 may participate in some other unknown processes modulated by BR in rice.

Phenotypic analysis

  • Rice plants overexpressing BU1(BU1:OX) showed enhanced bending of the lamina joint, increased grain size, and resistance to brassinazole, an inhibitor of BR biosynthesis.
  • In contrast to BU1:OX, RNAi plants designed to repress both BU1 and its homologs displayed erect leaves.
  • In addition, compared to the wild type, the induction of BU1 by exogenous brassinolide did not require de novo protein synthesis and it was weaker in a BR receptor mutant OsbriI (Oryza sativa brassinosteroid insensitive1, d61) and a rice G protein alpha subunit (RGA1) mutant d1.

Expression

  • Expression analyses showed that BU1 is expressed in several organs including lamina joint, phloem, and epithelial cells in embryos.

You can also add sub-section(s) at will.

Labs working on this gene

  • Disease Resistance Research Unit (A.T., H.N., C.T., M.O., C.-J.J., J.G.D., M.M.) and Plant Genome Research Unit (S.K.), National Institute of Agrobiological Sciences, Tsukuba 305–8602, Japan;
  • Graduate School of Science and Technology, Tokyo University of Science, Noda 278–8510, Japan (A.T., T.K.);
  • Institute of Society for Techno-Innovation of Agriculture, Forestry and Fisheries, Tsukuba 305–0854, Japan (Z.S.); Faculty of Agriculture, Utsunomiya University, Utsunomiya 321–8505, Japan (C.T., H.S.);
  • Department of Bioscience, Teikyo University, Utsunomiya 320–8551, Japan (T.N., T.Y.); a
  • Department of Applied Biological Chemistry, University of Tokyo, Tokyo 113–8657, Japan (T.A.)

References

  1. Tanaka A, Nakagawa H, Tomita C, Shimatani Z, Ohtake M, Nomura T, Jiang CJ, Dubouzet JG, Kikuchi S, Sekimoto H, Yokota T, Asami T, Kamakura T, Mori M. BRASSINOSTEROID UPREGULATED1, encoding a helix-loop-helix protein, is a novel gene involved in brassinosteroid signaling and controls bending of the lamina joint in rice. Plant Physiol. 2009 Oct;151(2):669-80. doi: 10.1104/pp.109.140806. PubMed PMID: 19648232; PubMed Central PMCID: PMC2754635.

Structured Information