Difference between revisions of "Os01g0257300"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
 
(8 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0257300''''' was reported as '''''OsRAA1''''' in 2004 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
''OsRAA1'' (Oryza sativa Root Architecture Associated1) encodes a small protein (109 aa in length) conserved in plants including -GVWV/IF domain,
+
* '''''OsRAA1''''' is a new gene functions in the development of rice root systems, which are mediated by auxin.
-GWERYY domain ,-DLIS/ALP- and -H/YMYDI/VVV/I- domain.
+
* A positive feedback regulation mechanism of '''''OsRAA1''''' to indole-3-acetic acid metabolism may be involved in rice root development in nature.
The OsRAA1 promoter(1,987 bp in length)includes elements of GA and auxin response, but it was a very weak response to GA3 treatment and it probably regulated by auxin.
 
The OsRAA1 mRNA was specifically transcripted in the organs of roots and spikes, including root apex, cortex of root apical meristem ,pericycle of root apex, lateral roots, apical meristem of young spikes, collenchyma cells of margin vascular bundles between shoot and roots.In Ubi::OsRAA1 transgenic plants, overexpression ''OsRAA1'' in the root results in reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic, which are similar to the phenotypes of the wild-type plant treated with auxin. Furthermore, the leaves and filaments are longer at the last stage of plant development in the transgenic plants. ''OsRAA1'' expression is induced by auxin. At the same time, overexpression of ''OsRAA1'' also causes endogenous indole-3-acetic acid to increase. These data suggest that ''OsRAA1'' as a new gene functions in the development of rice root systems,which are mediated by auxin.
 
  
OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.
+
===Phenotypic analysis===
 +
* Constitutive expression of '''''OsRAA1''''' under the control of maize (Zea mays) ubiquitin promoter resulted in phenotypes of reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic response of roots in seedlings of rice (Oryza sativa), which are similar to the phenotypes of the wild-type plant treated with auxin.  
 +
* With overexpression of '''''OsRAA1''''', initiation and growth of adventitious root were more sensitive to treatment of auxin than those of the control plants, while their responses to 9-hydroxyfluorene-9-carboxylic acid in both transgenic line and wild type showed similar results.  
 +
* '''''OsRAA1''''' constitutive expression also caused longer leaves and sterile florets at the last stage of plant development.  
 +
* Analysis of northern blot and GUS activity staining of OsRAA1::GUS transgenic plants demonstrated that the '''''OsRAA1''''' expression was induced by auxin.
 +
* At the same time, overexpression of OsRAA1 also caused endogenous indole-3- acetic acid to increase.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Data of in situ hybridization and OsRAA1::GUS transgenic plant showed that '''''OsRAA1''''' expressed specifically in the apical meristem, the elongation zone of root tip, steles of the branch zone, and the young lateral root.
Immunoassay of a cell line with GFP alone showed immunofluorescence in the whole cell during the cell cycle.In contrast, in the OsRAA1-GFP transgenic line, OsRAA1 GFP was enriched at spindles, including tubulins, from metaphase to anaphase during cell division
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* '''''OsRAA1''''' encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating root development yet.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, The Chinese Academy of Sciences, Beijing 100093, China
*OsRAA1 Interaction Protein Screening
 
*OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo
 
*Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells
 
*Degradation of OsRAA1 Depends on the Proteasome
 
*Two-Hybrid cDNA Library Construction and Screening
 
*Protein Deletion Mutation and Yeast Plasmid Construction
 
*Pull-Down Assay
 
*Immunofluorescence of Rice Root Tips
 
*Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis
 
*Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line
 
*Transient Subcellular Localization
 
*Determination of the Half-Life of OsRAA1
 
*Protein Degradation Assay in Vitro
 
*Morphological Examination of Transformed S. pombeCells
 
  
 
==References==
 
==References==
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855
+
<references>
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513
+
* <ref name="ref1">
 +
Ge L, Chen H, Jiang JF, Zhao Y, Xu ML, Xu YY, Tan KH, Xu ZH, Chong K.
 +
Overexpression of OsRAA1 causes pleiotropic phenotypes in transgenic rice plants,
 +
including altered leaf, flower, and root development and root response to
 +
gravity. Plant Physiol. 2004 Jul;135(3):1502-13. PubMed PMID: 15247372; PubMed
 +
Central PMCID: PMC519066.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0257300|
 
Description = Conserved hypothetical protein|
 
Version = NM_001049166.1 GI:115435745 GeneID:4326229|
 
Length = 785 bp|
 
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:8585137..8585921|
 
CDS = 8585497..8585826|
 
GCID = <gbrowseImage1>
 
name=NC_008394:8585137..8585921
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:8585137..8585921
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|
 
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS                    SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD                    SFRVVDA</aaseq>|
 
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 06:40, 6 March 2017

The rice Os01g0257300 was reported as OsRAA1 in 2004 [1] by researchers from China.

Annotated Information

Function

  • OsRAA1 is a new gene functions in the development of rice root systems, which are mediated by auxin.
  • A positive feedback regulation mechanism of OsRAA1 to indole-3-acetic acid metabolism may be involved in rice root development in nature.

Phenotypic analysis

  • Constitutive expression of OsRAA1 under the control of maize (Zea mays) ubiquitin promoter resulted in phenotypes of reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic response of roots in seedlings of rice (Oryza sativa), which are similar to the phenotypes of the wild-type plant treated with auxin.
  • With overexpression of OsRAA1, initiation and growth of adventitious root were more sensitive to treatment of auxin than those of the control plants, while their responses to 9-hydroxyfluorene-9-carboxylic acid in both transgenic line and wild type showed similar results.
  • OsRAA1 constitutive expression also caused longer leaves and sterile florets at the last stage of plant development.
  • Analysis of northern blot and GUS activity staining of OsRAA1::GUS transgenic plants demonstrated that the OsRAA1 expression was induced by auxin.
  • At the same time, overexpression of OsRAA1 also caused endogenous indole-3- acetic acid to increase.

Expression

  • Data of in situ hybridization and OsRAA1::GUS transgenic plant showed that OsRAA1 expressed specifically in the apical meristem, the elongation zone of root tip, steles of the branch zone, and the young lateral root.

Evolution

  • OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating root development yet.

You can also add sub-section(s) at will.

Labs working on this gene

  • Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, The Chinese Academy of Sciences, Beijing 100093, China

References

  1. Ge L, Chen H, Jiang JF, Zhao Y, Xu ML, Xu YY, Tan KH, Xu ZH, Chong K. Overexpression of OsRAA1 causes pleiotropic phenotypes in transgenic rice plants, including altered leaf, flower, and root development and root response to gravity. Plant Physiol. 2004 Jul;135(3):1502-13. PubMed PMID: 15247372; PubMed Central PMCID: PMC519066.

Structured Information