|
|
| (7 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os09g0456200''''' was reported as '''''OsbZIP72''''' in 2009 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os09g0456200''''' '''''<=>''''' '''''OsbZIP72,bZIP72,OsAREB2, OsABF4, Osbzip72''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | OsbZIP72 was an important regulator in abiotic stress response and ABA signaling transduction pathway[1].
| + | * Abscisic Acid (ABA) is an important phytohormone involved in abiotic stress resistance in plants. |
| − | The phytohormone abscisic acid (ABA) plays an essential role in plant adaption to drought stress.When stress was sensed by plants, the ABA level was elevated, which consequently activated the ABA response genes. A major group of transactivation factors binding to ABREs (ABA responsive elements) were basic leucine zipper proteins (bZIPs) that contained basic regions for DNA binding and leucine zipper regions for dimerization[2] [3] [4].
| + | * A group of bZIP transcription factors play important roles in the ABA signaling pathway in Arabidopsis. |
| − | Yeast one hybrid experiment in this study showed that OsbZIP72 could specifically bind to ABRE element . This result indicated that OsbZIP72 could bind to the ABRE in promoters of the down stream genes and was involved in the ABA signaling pathway.In vivo analysis of TRAB1 showed that it could transactivate the downstream reporter genes in response to ABA application[5].
| + | * The rice '''''OsbZIP72''''' was proved to be an ABRE binding factor in rice. |
| | + | * '''''OsbZIP72''''' was an important regulator in abiotic stress response and ABA signaling transduction pathway. |
| | + | * '''''OsbZIP72''''' plays a positive role in drought resistance through ABA signaling, and is potential useful for engineering drought tolerant rice. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | The expression levels of OsbZIP72were relatively high in all tissues, and the expression levels were induced by PEG, NaCl, Cold, ABA and ACC(Guojun et al.2009). As compared among different tissues of the same genes,the expression levels of OsbZIP72 were relatively low in both root and stem(Guojun et al.2009). | + | * Quantitative RT-PCR that the expressions of most of the OsbZIPs were signiWcantly induced by ABA, ACC, and abiotic stresses. |
| − | The expression pattern in response to environmental stresses and several hormones was also investigated. The expression levels of OsbZIP72were elevated by MeJA and NAA treatment, while, repressed by pathogen treatment(Guojun et al.2009).
| + | * The expression levels of OsbZIP72were relatively high in all tissues, and the expression levels were induced by PEG, NaCl, Cold, ABA and ACC[1]. |
| − | The enhancement of drought tolerance by overexpression of several group A AtbZIPs has been reported (Kang et al. 2002; Oh et al.2005).OsbZIP72is the first positive regulator identified in this group for rice drought tolerance. Transgenic rice plants overexpressing OsbZIP72 were hypersensitive to ABA and had elevated expression of the ABA responsive genes.
| + | * As compared among different tissues of the same genes, the expression levels of OsbZIP72 were relatively low in both root and stem[1]. |
| − | | |
| − | ===Evolution===
| |
| − | In order to better understand the relationships within the group A bZIPs of rice and Arabidopsis, the entire protein sequences of this group from rice and Arabidopsis were aligned and a bootstrap NJ-tree was constructed using ClustalX (Thompson et al. 1997) (Fig.1). According to this phylogenetic tree, all of the bZIPs could be classified into three subgroups. Each subgroup contains both rice and Arabidopsis bZIPs, indicating that the divergence of these subgroups predated the divergence of dicots and monocots. It also indicated that the protein sequences of these bZIPs were well conserved between dicots and monocots(Guojun et al.2009).
| |
| − | | |
| − | | |
| − | [[File:tu.jpg]]
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, 200233 Shanghai, China |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Guojun Lu;Chenxi Gao;Xingnan Zheng;Bin Han(2009) Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice. Planta, 229(3): 605-615 |
| | + | |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os09g0456200|
| |
| − | Description = Similar to BZIP transcription factor ABI5|
| |
| − | Version = NM_001069897.1 GI:115479536 GeneID:4347257|
| |
| − | Length = 3914 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os09g0456200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:17843808..17847721|
| |
| − | CDS = 17843880..17844830,17845124..17845195,17846037..17846066,17847106..17847183|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:17843808..17847721
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:17843808..17847721
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgctgacggataggtggggagggaggagggaggcgatggagttcgggaacggcgggtcctcctcgtcggagcgcagggcggcggcggagggggcgacgctggcgagacagggttcggtgtattcgctgacgttcgacgagttccagagcgcgctcgctggtggcggcggcggcggcggtggtggaagcgggttcgggaaggacttcggctccatgaacatggacgagctgctccggagcatctggaccgcggaggagagccaggccatggcctccgcctctggctccgccgcgggggtgggcgtggccgtgggggcgccgccgacgtcgctgcagcgccagggctcgctcaccctgccccgcacgctcagcgccaagacggtggacgaggtatggcgcaaccttgtgcgcgacgagccaccgccggtgggggcggcggatggcggcgatatgccaccccagcggcagtcgaccctcggggagatgaccctggaggagttcttggtcagagccggcgtggtccgagaaaatccacccgctgcgccgccccccgttcccccgccaatgccgccgcggccagtcccggtggtccccaagaccactgccttcttgggaaacttccccggtgccaacgatgccggcgcggcggcgctgggctttgcgccgctcggcatgggggatccagccttgggcaatggcctgatgcccagggcagtgccagtgggcttgcctggcgccgccgtcgctatgcaaacagcggtgaaccagtttgattctggcgataaggggaacagcgacctgtcatcgccgacggagccaatgccttattccttcgaagggttggtgagggggagaaggaacggtggcggagtagagaaagtggtggagaggaggcagaggaggatgatcaagaacagggagtccgcggcgagatcccgcgcgcgcaagcaggcttacacattggaattggaagctgaagttcagaaactcaaggagatgaacaaggaattggagaggaaacaggcagatatcatggaaatgcagaaaaatgaggtagaagaaatgataaaggatccatttggaagaaggaagagactttgcttgcgaagaacactgactggtccctggtga</cdnaseq>|
| |
| − | AA = <aaseq>MLTDRWGGRREAMEFGNGGSSSSERRAAAEGATLARQGSVYSLT FDEFQSALAGGGGGGGGGSGFGKDFGSMNMDELLRSIWTAEESQAMASASGSAAGVGV AVGAPPTSLQRQGSLTLPRTLSAKTVDEVWRNLVRDEPPPVGAADGGDMPPQRQSTLG EMTLEEFLVRAGVVRENPPAAPPPVPPPMPPRPVPVVPKTTAFLGNFPGANDAGAAAL GFAPLGMGDPALGNGLMPRAVPVGLPGAAVAMQTAVNQFDSGDKGNSDLSSPTEPMPY SFEGLVRGRRNGGGVEKVVERRQRRMIKNRESAARSRARKQAYTLELEAEVQKLKEMN KELERKQADIMEMQKNEVEEMIKDPFGRRKRLCLRRTLTGPW</aaseq>|
| |
| − | DNA = <dnaseqindica>73..1023#1317..1388#2230..2259#3299..3376#gactcgtggcgatcctgagcttctttgggcgtcgaattcctgtggtgcgcggccggcgtggtgcgttgcttgatgctgacggataggtggggagggaggagggaggcgatggagttcgggaacggcgggtcctcctcgtcggagcgcagggcggcggcggagggggcgacgctggcgagacagggttcggtgtattcgctgacgttcgacgagttccagagcgcgctcgctggtggcggcggcggcggcggtggtggaagcgggttcgggaaggacttcggctccatgaacatggacgagctgctccggagcatctggaccgcggaggagagccaggccatggcctccgcctctggctccgccgcgggggtgggcgtggccgtgggggcgccgccgacgtcgctgcagcgccagggctcgctcaccctgccccgcacgctcagcgccaagacggtggacgaggtatggcgcaaccttgtgcgcgacgagccaccgccggtgggggcggcggatggcggcgatatgccaccccagcggcagtcgaccctcggggagatgaccctggaggagttcttggtcagagccggcgtggtccgagaaaatccacccgctgcgccgccccccgttcccccgccaatgccgccgcggccagtcccggtggtccccaagaccactgccttcttgggaaacttccccggtgccaacgatgccggcgcggcggcgctgggctttgcgccgctcggcatgggggatccagccttgggcaatggcctgatgcccagggcagtgccagtgggcttgcctggcgccgccgtcgctatgcaaacagcggtgaaccagtttgattctggcgataaggggaacagcgacctgtcatcgccgacggagccaatgccttattccttcgaagggttggtgagggggagaaggaacggtggcggagtagagaaagtggtggagaggaggcagaggaggatgatcaagaacagggagtccgcggcgagatcccgcgcgcgcaagcaggtcttaaactctaaattctttgtactgattatgcatctattgctattggaaccattctgtgagagtgccaagttgttgagcctacctcaaaataagatgatagaaatactattggcagtaacttagtttactggagtttcccatggcatgctaatcttagcaactataatcaaactttgtgttatatgagcagagctgttggctagtttgttcatccctgttatggattttgtttaaaagcagataatttcatcaaatttcctgtcttgctaacaatttccttattggaaaaggcttacacattggaattggaagctgaagttcagaaactcaaggagatgaacaaggaattggagaggaaacaggtttctttctgacaaactctgttgtagaatgttgaatggactattagcacatgattaattaagttttaattattacaaacttgacaaatggatatatttgatattttaaaataacttctatatagaaagttttcccacgaaacacaccgtttagcggtttgaaaagcgtgctaacggaaactgaggtaaaatttgtatagtctcctttcagtataaagaacaaggcctacttttagtatagtctccttaagaaggatttatactgctgttctaaaactcgtagcttcagttcttaaaccccagtattagctgctttgcttctctgttcatgttcatgacatcagagggttcaaacagggttcactatgacttgctctttcgaagtaatgcatatgtttctcagaaacaaagcccattgtgtccaacattgagtttctcttttagaataatcttccaatgttgctgcagtaatagtttcaattccttgtctaggaagaaaatttttttcatatctgacatgatgccaacagccctgttgcctacgtacacaaaacgcatattacccagcttgcacttcttataaatgattggtgaacatgtcggtaaattagggctcaagtatcatacttgaagtttatcatttttatagactttttttttattccagtctatgcggaaagcatgcaatcaaccatctattattacaaaattttagggctttatccataggctaccgaccaatgctagcaaatagcactcgtttacagaattcaaagtttggatatgctcatagcgtactcctttgagagtcctgatattttctttttcttccatcttgcaggcagatatcatggaaatgcagaaaaatgaggtaattgctttcgtcgtttgtttatgtcaaatgtgtgcccttgacacttttctctgtttttacagttacaactataataaatgtcaagataacgctatgtgctgtctgcttaattttttactatgtttttagcttaatttcatttcactttctgttgttcgcataatttagtctgaggttggaatgctggatgtgcatttgtgggacaaatgcttcaatacttacaagttacaacacaaatatttcgcacatgtaaactttgcattctctttcaggttattgcctacagatgctatcttccagttcgtttgttgaattgttgtccattctttttgtttcaaaacatttatttttaggtgttatgcttcttgtattcattacatgaagaaaaatctaggtcatttgctgctttcagttaaaacccttgcttctcattgtatgcacaagtatttttacatgctagcttattcgtgttctcattttctcattagtagactactttttatctcgtgtgtttttcatggcactatatgatggattttttttgacataatatatgatggaatttttattaattcttctttctctaatcaaaccatctcatattaatttggtaatttgtggaatccagtcctttttccttattttggtgtggattgtgctcatttctaagaacagagtagttgtgtagctgcagaatttctttatttctggtatatttacatatggttagctaaatttcatgaaaaacattttctgattttcagtactctctgaaaactactattatggtacaatgttatttgcagtttttctcgagccaatatctcccaagaactggagaaaaaattacttagtgattagcattattatccaaatcatagggttttgagcgtcgactcttgcaaaattcaacttccagtaccataccatttcattcagtattcagcgaacctgcttgtcagaaaaaaagtgtggaacgggtattttatcgtattttacctgtgtaactgcttaaattttgtttcactgcttataggtagaagaaatgataaaggatccatttggaagaaggaagagactttgcttgcgaagaacactgactggtccctggtgatgacgagtggtcgatggcatgcaaattcccaccttcatcagcgactgtgcataatttaatctgttgtaaaccaatggtggacgaacttgtgcttgattaatcttctagtttcatttttcctgctagctgattctgagaaggcttccaaaactgacatgtagattatgtgtagacgaatgaagctgtcagaacaacttcctgtaatccttgagaaaacttgtatagtgttgtctaggtttgtatcatgctagtctttctatctagtgtcccaccctagagaccagacatcttggatgagttcagaggtcgatttaagcaagtcatggggaccaagaatcatactgcaacctgcctgatgactagctaagctaggtagtatgtagcaatatctgatatctgtacctgcttcctgaagtatgtattgttatctagtgtatctgatatctagcgtgtaaactgtaaaggagtataagcagacctagttctcaagaaaaaaaagtataagcagacctactaattgcttataagcctgttactt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069897.1 RefSeq:Os09g0456200]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |