Difference between revisions of "Os08g0126300"

From RiceWiki
Jump to: navigation, search
(References)
(Function)
 
(8 intermediate revisions by 3 users not shown)
Line 1: Line 1:
  
OsGAPDH is Glyceraldehyde-3-phosphate dehydrogenase in rice cytoplasm involved in the ubiquitous glycolysis.
+
The rice '''''Os08g0126300''''' was reported as '''''OsGAPC3''''' in 2011 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Domains of OsGAPDH monomer.jpg|right|thumb|275px|'''Figure 2.''' 'Domains of OsGAPDH monomer(from reference)<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os08g0126300''''' '''''<=>''''' '''''OsGapC3,GapC3'''''
 +
 
===Function===
 
===Function===
Glyceraldehyde-3-phosphate dehydrogenase involved in the ubiquitous glycolysis, catalyzes the oxidative phosphorylation of glyceraldehyde-3-phosphate to 1,3-biphosphoglycerate (BPG) using nicotinamide adenine dinucleotide (NAD) as an electron acceptor.
+
* '''''OsGAPC3 plays''''' important roles in salt stress tolerance in rice.
 
+
* Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is a highly conserved glycolytic enzyme that plays an important role in carbon economy.
the following reaction: G3P + NAD + Pi  → BPG + NADH
+
* Glyceraldehyde-3-phosphate dehydrogenase involved in the ubiquitous glycolysis, catalyzes the oxidative phosphorylation of glyceraldehyde-3-phosphate to 1,3-biphosphoglycerate (BPG) using nicotinamide adenine dinucleotide (NAD) as an electron acceptor. <ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" />
  
The homotetramer form of GADPH in vivo is proved to attribute many and diverse non-glycolytic functions, such as membrane fusion, phosphotransferase activity.<ref name="ref1" />.
+
* the following reaction: G3P + NAD + Pi  → BPG + NADH
 +
* The homotetramer form of GADPH in vivo is proved to attribute many and diverse non-glycolytic functions, such as membrane fusion, phosphotransferase activity.<ref name="ref1" />.
  
 
===Mutation===
 
===Mutation===
Line 26: Line 31:
  
 
===Expression===
 
===Expression===
 +
[[File:Structure of OsGAPDH (rotation of 908 along Y-axis).jpg|right|thumb|275px|'''Figure 1.''' 'Structure of OsGAPDH (rotation of 908 along Y-axis)(from reference)<ref name="ref1" />.'']]
 +
 
The expressions of the genes OsGAPDH  are dramatically induced by anaerobiosis  
 
The expressions of the genes OsGAPDH  are dramatically induced by anaerobiosis  
  
Line 42: Line 49:
  
  
===Extension===
+
===Knowledge Extension===
 
+
[[File:Electron density map and electrostatic surface around Phe37 in the NAD binding site from two structures.jpg|right|thumb|275px|'''Figure 3.''' 'Electron density map and electrostatic surface around Phe37 in the NAD binding site from two structures(from reference)<ref name="ref1" />.'']]
The crystal structure of OsGAPDH comprises a homotetramer of four monomers with non-crystallographic symmetries holding each other through hydrogen bonds in an asymmetric unit.
 
[[File:Structure of OsGAPDH (rotation of 908 along Y-axis).jpg|right|thumb|275px|'''Figure 1.''' 'Structure of OsGAPDH (rotation of 908 along Y-axis)(from reference)<ref name="ref1" />.'']]
 
 
 
  
The overall structure of the OsGAPDH monomer comprises three domains: a NAD-binding domain (residues 1–153 and 318–337), a catalytic domain (154–180 and 210–317) and an S-loop (181–209) .
+
* The crystal structure of OsGAPDH comprises a homotetramer of four monomers with non-crystallographic symmetries holding each other through hydrogen bonds in an asymmetric unit.
  
[[File:Domains of OsGAPDH monomer.jpg|right|thumb|275px|'''Figure 2.''' 'Domains of OsGAPDH monomer(from reference)<ref name="ref1" />.'']]
+
* The overall structure of the OsGAPDH monomer comprises three domains: a NAD-binding domain (residues 1–153 and 318–337), a catalytic domain (154–180 and 210–317) and an S-loop (181–209) .
  
Among four monomers of a homotetramer, the monomers A, B and C show the extra definable electron densities for NAD molecules, whereas monomer O exhibits the indistinct electron density<ref name="ref1" />.
+
* Among four monomers of a homotetramer, the monomers A, B and C show the extra definable electron densities for NAD molecules, whereas monomer O exhibits the indistinct electron density<ref name="ref1" />.
[[File:Electron density map and electrostatic surface around Phe37 in the NAD binding site from two structures.jpg|right|thumb|275px|'''Figure 3.''' 'Electron density map and electrostatic surface around Phe37 in the NAD binding site from two structures(from reference)<ref name="ref1" />.'']]
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 75: Line 78:
  
 
<references>
 
<references>
 +
<ref name="ref2">
 +
Zhang XH, Rao XL, Shi HT, Li RJ, Lu YT. Overexpression of a cytosolic glyceraldehyde-3-phosphate dehydrogenase gene OsGAPC3 confers salt tolerance in rice. Plant Cell, Tissue and Organ Culture (PCTOC). 2011 Oct 1;107(1):1.
 +
</ref>
 +
 
<ref name="ref1"> Yueh-Chu Tien;Phimonphan Chuankhayan;Yen-Chieh Huang;Chung-De Chen;Jahan Alikhajeh;Shou-Lin Chang;Chun-Jung Chen. Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis. Plant Molecular Biology[J], 2012, 80(4-5): 389-403.</ref>
 
<ref name="ref1"> Yueh-Chu Tien;Phimonphan Chuankhayan;Yen-Chieh Huang;Chung-De Chen;Jahan Alikhajeh;Shou-Lin Chang;Chun-Jung Chen. Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis. Plant Molecular Biology[J], 2012, 80(4-5): 389-403.</ref>
  
  
<ref name="ref2"> Pillai, M. A., et al.Molecular cloning, characterization, expression and chromosomal location of OsGAPDH, a submergence responsive gene in rice (Oryza sativa L.). Theoretical and Applied Genetics[J], 2002, 105(1): 34-42.</ref>
+
<ref name="ref3"> Pillai, M. A., et al.Molecular cloning, characterization, expression and chromosomal location of OsGAPDH, a submergence responsive gene in rice (Oryza sativa L.). Theoretical and Applied Genetics[J], 2002, 105(1): 34-42.</ref>
 
</references>
 
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os08g0126300|
 
Description = Similar to Glyceraldehyde-3-phosphate dehydrogenase (Fragment)|
 
Version = NM_001067432.1 GI:115474600 GeneID:4344564|
 
Length = 3782 bp|
 
Definition = Oryza sativa Japonica Group Os08g0126300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:1524413..1528194|
 
CDS = 1524488..1524491,1524625..1524648,1524764..1524864,1525152..1525267,1525360..1525459<br>,1526060..1526206,1526290..1526350,1526433..1526530,1526955..1527097<br>,1527327..1527410,1527538..1527627,1527722..1527767|
 
GCID = <gbrowseImage1>
 
name=NC_008401:1524413..1528194
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:1524413..1528194
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggcaagattaagatcggaatcaacggtttcggaaggatcgggaggctcgtggccagggtggccctccagagcgaggatgtcgagctcgtcgccgtcaacgaccccttcatcaccaccgactacatgacctacatgttcaagtacgataccgtgcacggccaatggaagcacagcgacatcaagatcaaggactccaagactctgctcttgggcgagaagccggtcaccgttttcggcatcaggaaccctgacgagattccgtgggctgaggctggtgctgagtatgtcgtggagtccaccggtgtcttcactgacaaggagaaggctgctgctcacttgaagggtggtgccaagaaggttgtcatctctgccccgagcaaagatgctccgatgtttgtctgcggtgtcaacgaggacaagtacacttcagatattgatattgtctcaaatgctagctgcaccacaaactgccttgctcctcttgccaaggtcattcatgacaactttggtattatcgagggtctgatgacaactgttcatgccatcactgccacccaaaagaccgttgatggaccgtccagcaaggactggaggggtggcagggcggccagttttaacatcattcccagcagcactggtgctgccaaagctgttggcaaggttcttcctgatttgaatggcaagcttacgggaatgtccttccgtgttcccactgtcgatgtctcagttgttgatctcacagttagaatcgagaaggctgcctcatatgatgctatcaagagtgctatcaagtctgcatcagagggaaagctcaagggaatcataggatatgttgaggaagacctggtttctactgactttgttggtgacagcaggtcgagcatcttcgacgccaaggctggaattgctcttaacgataactttgtcaagcttgtcgcctggtacgacaacgagtggggttacagcaaccgtgtcatcgacctgatccgccacatggccaagacccagtag</cdnaseq>|
 
AA = <aaseq>MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMT                    YMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTG                    VFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLA                    PLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKA                    VGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGII                    GYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMA                    KTQ</aaseq>|
 
DNA = <dnaseqindica>76..79#213..236#352..452#740..855#948..1047#1648..1794#1878..1938#2021..2118#2543..2685#2915..2998#3126..3215#3310..3355#tatccggcttccagacgcttctctcctcctctaatctcaagtctctgtctcgtcgtcctcgcatctccactcgccatgggtaattatgctcacctccgaatcgaattaattcccccgtttgattactgctggtgcttcgcgtcctgatctgattgatgtttttttttctgatttttttggtgaattttctggtggtgtttttggggacgcaggcaagattaagatcggaatcaacggtgagtttgctatctgaattactacgagtttgtgctgtgctgggtgtggtttcgttggatttgtggtgatttgagtgggggttttttgtgtgtttgggattgtgattttgttcaggtttcggaaggatcgggaggctcgtggccagggtggccctccagagcgaggatgtcgagctcgtcgccgtcaacgaccccttcatcaccaccgactacatggtacgctcttcgatctgtgggtttcaccgtcttcatgtgcagatctagtcgtttgtagggttctacagtggttttagctcagatatacatttgcgtgctcgctcaaagagatgtttagtggttgggagttgttttgattgagatatggcagttaattttcccagatctgagtactttttttcgcatgtttagttgctgaattatgctgtttgctactgcatatggctttgattttcgtgtggtgtgctcacgattgatgaattctatgttggtcgtgtgatttgcagacctacatgttcaagtacgataccgtgcacggccaatggaagcacagcgacatcaagatcaaggactccaagactctgctcttgggcgagaagccggtcaccgttttcggcatcaggtaacttgatattgatattacagcttagatgaaagtaacttgtttatggtagcgagcgtggaactgatgtttgatcctgtgcaatttgaaaggaaccctgacgagattccgtgggctgaggctggtgctgagtatgtcgtggagtccaccggtgtcttcactgacaaggagaaggctgctgctcacttgaaggtattatcactgttgcttttcattccaacaaattggcatattgttacatattgttcccatgggattgcatacaagcaagtaaataatgctatggttatttttaagaattaatggatgtagttagattacaaaatcttacacgattttgctaatgatggacacctttgtgtaaaagcatcattatctaactaaaagaaactaagcaatccatggtttttgattatgcataactaaatgtaggcagagatgtgccacaaggggaaagctcattaaaatttgaagtttatgaaccccagtgatatatgtcaaggtctttgcatttacccaaaaagatttggcctgcaaagttaagagtgactacctaagtcttctaaagttaggatgatgcatcacaaagcagacagctcctaattcttttgccttaatttcttaagtattagcatatataacttatggctttgtgttgtcaatttagttttttttattacttgatgccttgtttatttttactctgaaaagtacttgttgtgcatctcccttgttgcataagttagctatttcggtgcattttttatgcttacatggctgttctgaaaacagggtggtgccaagaaggttgtcatctctgccccgagcaaagatgctccgatgtttgtctgcggtgtcaacgaggacaagtacacttcagatattgatattgtctcaaatgctagctgcaccacaaactgccttgctcctcttgccaaggtatttttctttccgagtgacaattttctactttcagttggacttttggtttggttcttaattgactcgttatcatccaataggtcattcatgacaactttggtattatcgagggtctgatgacaactgttcatgccatcactggtaagactttcttggctttttggcagctaatatgaacatctagatgttctgtaatagctaacgctgatgtacttgttttcagccacccaaaagaccgttgatggaccgtccagcaaggactggaggggtggcagggcggccagttttaacatcattcccagcagcactggtgctgccaaagtacgtcatgaacttcaatgttgtgcatgcacaaccacagttcaaaatcctctttatagttccaataattttgtattctcctgtgttatggggctgcgtatagttttctttttgactttatttgggaatgttaagtagaagacccagtgataatagcaagtaactgcacaaatggcgcgcttgctgatttcagccctagagtttttgttgataaatgagcatgtgcgctgtctttattcaagtatgaattctctctcatgtcctatgacgaattgcttgctgttcatgcttctgttcagagttgtttctggcctgcttagggaaaagggggtgcatgtgggcggtagtttttggttgtgaaagcatgttttgttagtaaaatgggactgcagccttaatgacttctaacatcaatgcattgcaggctgttggcaaggttcttcctgatttgaatggcaagcttacgggaatgtccttccgtgttcccactgtcgatgtctcagttgttgatctcacagttagaatcgagaaggctgcctcatatgatgctatcaagagtgctatcaagtaagtatatagcttccaacgcaaggggaatgtacatctcattttgcgcactgttgctagaactgcatcttgtggcaggggataccgctcagtgatgtatgttactgaaacatacatgtgaaggattcctagaaaagtgtagttacgtgtgttggtgggcgcagaactgcacaagttatccttaagttagtagtgtgtccctgacgagaatatgctaattgttttacaggtctgcatcagagggaaagctcaagggaatcataggatatgttgaggaagacctggtttctactgactttgttggtgacagcaggtatgcctttttgtcttgagaggccctgtaagaaatctgtaatgcagatctgctccaaactaagtggttacggacgaactatctcctgtatgctatcattcattctctgtactcatctttgactcaggtcgagcatcttcgacgccaaggctggaattgctcttaacgataactttgtcaagcttgtcgcctggtacgacaacgagtggggttacaggtgagccacttgcagttcaaactattaaccatgtacaatactccatgcccaatttgctcttactgatctttcttttttgaactattttctgcagcaaccgtgtcatcgacctgatccgccacatggccaagacccagtagaatccttttgcttgccatggtattccatggccgccgagccggagataccggtatgctttgtctatgctgagaataaaacgtggacggtgttcatcaggacccaccccctctgttaatgctagttgggataatgagttgcattttgttttccaatctacctacttgtaagttgtaacgatgctgatgatatggacctgagtctacttttttgcttgtgaagaatataagccgtccagtgcagttgtaattttgttatgctggttgcatatatgggctttgtgtttggttcgtgctacctcttcacttctgcttgtttgtttggtcgtgtagggcaacgtctcatgatcagcttagtttgctctttcgtagttgctctcaatgtttattactccagaataacgtggcctttgcgattcagttgtgttgg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067432.1 RefSeq:Os08g0126300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 13:20, 6 March 2017

The rice Os08g0126300 was reported as OsGAPC3 in 2011 [1] by researchers from China.

Annotated Information

Figure 2. 'Domains of OsGAPDH monomer(from reference)[1].

Gene Symbol

  • Os08g0126300 <=> OsGapC3,GapC3

Function

  • OsGAPC3 plays important roles in salt stress tolerance in rice.
  • Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is a highly conserved glycolytic enzyme that plays an important role in carbon economy.
  • Glyceraldehyde-3-phosphate dehydrogenase involved in the ubiquitous glycolysis, catalyzes the oxidative phosphorylation of glyceraldehyde-3-phosphate to 1,3-biphosphoglycerate (BPG) using nicotinamide adenine dinucleotide (NAD) as an electron acceptor. [1] [2] [3]
  • the following reaction: G3P + NAD + Pi → BPG + NADH
  • The homotetramer form of GADPH in vivo is proved to attribute many and diverse non-glycolytic functions, such as membrane fusion, phosphotransferase activity.[1].

Mutation

Phe37 plays a crucial role in stabilizing NAD binding or intermediating of apoholo transition, resulting in a greater NAD-dependent catalytic efficiency using site-directed mutagenesis

The kinetic parameters of OsGAPDH showed that the mutation on Phe37 has a significant effect on the catalytic rate and NAD specificity, but does not lead to NADP-dependent activity of OsGAPDH.

Wild type OsGAPDH exhibited the fluorescence intensity with a linear decrease, revealing that the binding of NAD to each subunit induced the same decrease of the fluorescence intensity.

Asp35 and Pro193 of OsGAPDH are conserved residues for the NAD specificity. The mutation F37T, F37L and F37G provid the evidence to elucidate that Phe37 is one key residue for catalysis as its single substitutions gave extremely low activities compared with wild-type OsGAPDH.

In contrast, the dissociation constants K for NAD and NADH binding were increased in the following order: wild type\F37G\F37T\F37L (Table 7). The result supports that a substitution of Phe37 for small aliphatic (Gly or Leu) or polar (Thr) residues could almost abolish the NAD-binding affinity to attenuate the catalytic efficiency of OsGAPDH

The smaller side chains of Gly, Leu and Thr might not form a bottleneck or hold NAD stably into the coenzyme-binding site, resulting in attenuated NAD binding affinities and catalytic efficiency.

According to this apo-holo transition mechanism, a lack of the bottleneck in F37G, F37L or F37T mutants not only decreases the NAD binding affinity but also retards apo-holo transitions, resulting in a greatly diminished catalytic rate or efficiency of cytosolic OsGAPDH.[1].

Expression

Figure 1. 'Structure of OsGAPDH (rotation of 908 along Y-axis)(from reference)[1].

The expressions of the genes OsGAPDH are dramatically induced by anaerobiosis

Northern hybridization using total RNA extracted from several organs showed that OsGAPDH was expressed at a high level in the panicle.

Expression analysis of various environmental stresses and growth hormones indicated a coordinate suppression after cold, salt and exogenous application of mannitol and ethephon treatment. Concomitantly, an increase in mRNA accumulation has been noted on drought, submergence and ABA treatments.

The time-course expression of the OsGAPDH transcript was found out under drought, submergence stress and ABA treatment. For drought treatment the highest rate of OsGAPDH transcript accumulation took place at 12-h treatment. However, a decreased transcript level was noticed on the next day and then the accumulation reached a maximum level after 3-days of drought treatment. A stronger submergence response was observed in the 12-h treatment; subsequently the expression declined progressively. The plant hormone ABA showed strong induction within 1 day of treatment and thereafter the transcript level decreased slightly under 2 and 3 days of treatment

Since purified GAPDH activity was inhibited by ATP, ADP, and the metabolites PEP and PGA, the enzyme activity may be regulated by these metabolites under certain physiological conditions.[2].

Evolution

A multiple amino-acid sequence alignment of OsGAPDH with other GAPDH enzymes from various species, including Homo sapien, Oryctolagus cuniculus, Escherichia coli, Bacillus stearomorphilius and Spinacia oleracea, reveals sequence identities 45–68 % with several conserved regions, especially residues 150–170 for the substrate binding.[1].

the deduced amino acid sequence showed a significant similarity to the sequence of maize and, in other plants, non-reversible glyceraldehyde-3- phosphate dehydrogenase indicated that the enzyme was highly conserved. The rice nr-GAPDH sequence closely resembles nr-GAPDH from Zea mays (accession no X75326; 94% identity), Pisum sativum (accession no X75327; 89% identity), Nicotiana plumbaginifolia (accession no U87848; 88% identity) and Apium graveolens (accession no AF196292; 86% identity)[2].


Knowledge Extension

Figure 3. 'Electron density map and electrostatic surface around Phe37 in the NAD binding site from two structures(from reference)[1].
  • The crystal structure of OsGAPDH comprises a homotetramer of four monomers with non-crystallographic symmetries holding each other through hydrogen bonds in an asymmetric unit.
  • The overall structure of the OsGAPDH monomer comprises three domains: a NAD-binding domain (residues 1–153 and 318–337), a catalytic domain (154–180 and 210–317) and an S-loop (181–209) .
  • Among four monomers of a homotetramer, the monomers A, B and C show the extra definable electron densities for NAD molecules, whereas monomer O exhibits the indistinct electron density[1].

Labs working on this gene

1. Life Science Group, Scientific Research Division, National Synchrotron Radiation Research Center, Hsinchu, 30076, Taiwan

2. Institute of Structural Biology and Bioinformatics, National Tsing Hua University, Hsinchu, 30043, Taiwan

3. Department of Physics, National Tsing Hua University, Hsinchu, 30043, Taiwan

6. Department of Food Borne and Diarrheal Diseases, Research Center for Gastroenterology and Liver Diseases, Shaheed Beheshti MC, Velenjak, Shahid Chamran Highway, Tehran, Iran

4. Institute of Biotechnology, National Cheng Kung University, Tainan City, 70101, Taiwan

5. University Center for Bioscience and Biotechnology, National Cheng Kung University, Tainan City, 70101, Taiwan

6. Department of Low Temperature Science, Hokkaido National Agricultural Experiment Station, 1 Hitsujigaoka, Toyohira, Sapporo, Hokkaido 062-8555, Japan

7. Institute of Genetics, Chinese Academy of Sciences, Beijing 100101, China,

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Yueh-Chu Tien;Phimonphan Chuankhayan;Yen-Chieh Huang;Chung-De Chen;Jahan Alikhajeh;Shou-Lin Chang;Chun-Jung Chen. Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis. Plant Molecular Biology[J], 2012, 80(4-5): 389-403.
  2. 2.0 2.1 2.2 Zhang XH, Rao XL, Shi HT, Li RJ, Lu YT. Overexpression of a cytosolic glyceraldehyde-3-phosphate dehydrogenase gene OsGAPC3 confers salt tolerance in rice. Plant Cell, Tissue and Organ Culture (PCTOC). 2011 Oct 1;107(1):1.
  3. Pillai, M. A., et al.Molecular cloning, characterization, expression and chromosomal location of OsGAPDH, a submergence responsive gene in rice (Oryza sativa L.). Theoretical and Applied Genetics[J], 2002, 105(1): 34-42.

Structured Information